KEGG   Sinocyclocheilus grahami: 107549001Help
Entry
107549001         CDS       T04918                                 

Gene name
ash2l
Definition
(RefSeq) set1/Ash2 histone methyltransferase complex subunit ASH2 isoform X1
  KO
K14964  Set1/Ash2 histone methyltransferase complex subunit ASH2
Organism
sgh  Sinocyclocheilus grahami
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sgh03036]
    107549001 (ash2l)
Chromosome and associated proteins [BR:sgh03036]
 Eukaryotic type
  Histone modification proteins
   HMT complexes
    COMPASS/SET1 complex
     107549001 (ash2l)
    MLL-HCF complex
     107549001 (ash2l)
    MLL3/MLL4 complex
     107549001 (ash2l)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SPRY
Motif
Other DBs
NCBI-GeneID: 107549001
NCBI-ProteinID: XP_016085377
LinkDB All DBs
Position
Unknown
AA seq 590 aa AA seqDB search
MAAEAGSVPERDTAEGDASFGDLTTNMETESSSGKETMDTAGDSSEAADAQTGSGDDENG
RQLGEVELQCALCMKWFTADTFSIDTATCLPFVTNYVFHCNVCHHSGNTYFLRKQANLKE
MCLTTLANLTWRSRTQEEHPKTMFSKDKDIIPFIDKYWECMTTRQRPGKLTWPNNIVKTM
SKERDVFLVKEHPDPGSKDPEEDYPKFGLLDQDLANIGPSYDSQKQMTAITGSGGLNGGS
TFSGGLPPAATGKGRGAKRKQQQLQDGAAAGTAKRTRSDPLFSAQRLPPHGYPLEHPFNK
DGYRYILAEPDPHAPDPEKLELDCWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDR
LTVTGEKGYSMVRASHGVRKGAWYFEVTVDEMPQDTAARLGWSQPLGNLQAPLGYDKFSY
SWRSKKGTRFHQSIGKHYSDSYGQGDILGFYIELPDDTETAKALPDTYKDKALIKFKSYL
YFEEKDYVDKAEKSLKPTSSSRIIFFKNGVNQGVAYEDLYEGMYYPAISLYKSCTVSVNF
GPHFKYPPKDIKHQPISDMGWSAVTEHTLSDMLYHVETDVDGRRSPPWEG
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atggctgccgaggcgggatctgtgccggagagagacacagcagaaggagatgcatcgttt
ggagatctgaccacaaacatggagacggagtcgtccagtggaaaagagactatggacacg
gcgggtgacagctcggaggcggcggatgcacagacggggtctggagacgatgagaacggc
cgtcagctgggggaagtggagctgcagtgtgcgctgtgcatgaagtggtttactgcagac
acgttcagcatcgacacggcaacttgcctgcccttcgtgaccaattatgtgtttcactgc
aatgtgtgtcaccacagcggaaacacgtacttcttgaggaaacaagcaaatctgaaggag
atgtgtctcaccactttggcgaatctgacatggaggtccagaactcaagaggagcatccc
aaaacaatgttctctaaagataaggacatcatacctttcattgacaaatactgggagtgc
atgacgacccgccagaggcccggcaaactcacatggccaaataacatcgtcaagactatg
agtaaagagcgtgatgttttcctggtgaaagaacatccagaccccggcagtaaagaccct
gaagaggactatcccaagtttggtttgcttgatcaggatctggccaatattggaccatcg
tatgacagccagaagcagatgacggccatcacgggttctggaggattgaatggtggatcg
actttttcaggtgggcttcctccagctgctacaggaaaaggcagaggagccaaacgcaaa
caacagcagctgcaggatggagctgcggctggaacggccaagagaacacgcagtgacccg
ctgttctcagcgcagcgtctgccgccccatggttaccctctcgaacaccccttcaacaaa
gacgggtaccgctacatcctagccgagccggatccccacgctcctgacccggaaaaactg
gagctggactgctgggccgggaagcccatccctggagacctgtaccgcgcgtgtctgtac
gagagagtgctgctggcgctgcatgaccgagctccacagctgaagatttcagacgaccgc
ctgacggtgaccggagagaagggctactcgatggtccgagcgtctcatggggtcagaaag
ggcgcgtggtattttgaggtcactgttgacgagatgccacaggacaccgcggctcgactg
ggctggtcgcagcctttaggaaacctgcaagctcctctgggttacgataagttcagctac
tcgtggcgaagtaagaaaggaacgcgcttccatcagtccattggaaagcattactctgac
agctacggacagggagacatcttgggattctacattgagcttccagatgacaccgaaacc
gccaaggctctgcctgacacgtacaaggacaaagcgctgatcaaattcaaaagctatttg
tactttgaagagaaagattacgtggacaaggccgagaagagtttaaaacccaccagttcc
agtcgaattatattttttaagaatggagtgaatcaaggtgtggcctatgaggatctgtac
gagggcatgtactaccccgccatatccctctacaagagctgcacggtgtctgttaatttt
ggaccacacttcaaatacccaccaaaagacatcaagcatcagccaataagtgacatgggt
tggagtgctgtgactgaacacacgctgtctgatatgctgtaccatgtagagaccgatgta
gacggccgacgcagccccccgtgggagggttaa

DBGET integrated database retrieval system