KEGG   Sinocyclocheilus grahami: 107549297
Entry
107549297         CDS       T04918                                 

Definition
(RefSeq) rho-related GTP-binding protein RhoA-D-like
  KO
K04513  Ras homolog gene family, member A
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04144  Endocytosis
sgh04150  mTOR signaling pathway
sgh04270  Vascular smooth muscle contraction
sgh04310  Wnt signaling pathway
sgh04350  TGF-beta signaling pathway
sgh04510  Focal adhesion
sgh04520  Adherens junction
sgh04530  Tight junction
sgh04621  NOD-like receptor signaling pathway
sgh04625  C-type lectin receptor signaling pathway
sgh04810  Regulation of actin cytoskeleton
sgh05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107549297
   04350 TGF-beta signaling pathway
    107549297
   04150 mTOR signaling pathway
    107549297
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107549297
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107549297
   04520 Adherens junction
    107549297
   04530 Tight junction
    107549297
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107549297
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    107549297
   04625 C-type lectin receptor signaling pathway
    107549297
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107549297
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107549297
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sgh04131]
    107549297
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sgh04147]
    107549297
   04031 GTP-binding proteins [BR:sgh04031]
    107549297
Membrane trafficking [BR:sgh04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    107549297
Exosome [BR:sgh04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107549297
  Exosomal proteins of other body fluids (saliva and urine)
   107549297
  Exosomal proteins of colorectal cancer cells
   107549297
  Exosomal proteins of bladder cancer cells
   107549297
GTP-binding proteins [BR:sgh04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    107549297
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU
Other DBs
NCBI-GeneID: 107549297
NCBI-ProteinID: XP_016085822
LinkDB
Position
Unknown
AA seq 170 aa
MENSREFHAFQTLLHHKRLLLIRSNCDPQVELALWDTAGQEDYDRLRPLSYPDTDVILMC
FSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELTKMKQEPVKPEE
GRDMANRISAFGYLECSAKSKEGVREVFEMATRAALQVRKRKKRSGCLLL
NT seq 513 nt   +upstreamnt  +downstreamnt
atggaaaacagcagggaattccatgcgtttcagaccctgctacatcataaaaggctttta
ctcattcggtccaattgtgatccacaggtggagctggcattgtgggacacagcaggacag
gaagactacgatcgtctgaggcctctgtcttatccagacacagatgtcatcctcatgtgt
ttctccattgacagtcccgacagtttagagaacattccagaaaagtggacgcctgaggtg
aagcacttctgccccaacgttcccataatcctggtgggcaataagaaggatctgcggaac
gatgaacacacacggagagagctgactaagatgaagcaggagccagttaaaccggaggag
ggcagggacatggccaaccgcatcagcgcctttggctacctggagtgctccgctaaatct
aaggagggcgtgagggaagtattcgaaatggccaccagggcggcgctgcaagtccgcaag
aggaagaagaggagcgggtgcttgctgttgtga

KEGG   Sinocyclocheilus grahami: 107556503
Entry
107556503         CDS       T04918                                 

Definition
(RefSeq) rho-related GTP-binding protein RhoA-B-like
  KO
K04513  Ras homolog gene family, member A
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04144  Endocytosis
sgh04150  mTOR signaling pathway
sgh04270  Vascular smooth muscle contraction
sgh04310  Wnt signaling pathway
sgh04350  TGF-beta signaling pathway
sgh04510  Focal adhesion
sgh04520  Adherens junction
sgh04530  Tight junction
sgh04621  NOD-like receptor signaling pathway
sgh04625  C-type lectin receptor signaling pathway
sgh04810  Regulation of actin cytoskeleton
sgh05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107556503
   04350 TGF-beta signaling pathway
    107556503
   04150 mTOR signaling pathway
    107556503
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107556503
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107556503
   04520 Adherens junction
    107556503
   04530 Tight junction
    107556503
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107556503
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    107556503
   04625 C-type lectin receptor signaling pathway
    107556503
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107556503
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107556503
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sgh04131]
    107556503
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sgh04147]
    107556503
   04031 GTP-binding proteins [BR:sgh04031]
    107556503
Membrane trafficking [BR:sgh04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    107556503
Exosome [BR:sgh04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107556503
  Exosomal proteins of other body fluids (saliva and urine)
   107556503
  Exosomal proteins of colorectal cancer cells
   107556503
  Exosomal proteins of bladder cancer cells
   107556503
GTP-binding proteins [BR:sgh04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    107556503
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA VASP_tetra
Other DBs
NCBI-GeneID: 107556503
NCBI-ProteinID: XP_016095124
UniProt: A0A672KU53
LinkDB
Position
Unknown
AA seq 193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELTKMKQEPVKAEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
ARRGKKSNKCSLL
NT seq 582 nt   +upstreamnt  +downstreamnt
atggcagcgattcgcaagaagctggtgattgtaggagatggagcgtgcggtaaaacctgt
ttgcttatcgtgttcagtaaagaccagtttcctgaagtctatgtccccacggtgtttgag
aactatgtcgccgacattgaggttgacagcaaacaggtggaacttgctctctgggatacc
gcaggacaggaggactatgataggctccgccctctttcgtacccagacactgatgtcatt
cttatgtgcttctctgttgacagtcctgacagtttagagaatattccagagaagtggaca
cctgaggtgaagcacttttgtccaaacgttcccatcatcctcgtcggcaacaaaaaggac
ttgcggaatgatgaacacacacgcagggagctgactaagatgaagcaggagcctgttaag
gcagaggaaggaagagacatggccaatcggattggtgcatttggttacatggagtgctca
gccaaaacaaaagatggcgttcgggaggtgtttgaaatggccactagagcggcgctgcag
gcacgcaggggaaagaagagcaacaaatgcagtctgctgtga

KEGG   Sinocyclocheilus grahami: 107558917
Entry
107558917         CDS       T04918                                 

Definition
(RefSeq) rho-related GTP-binding protein RhoA-C
  KO
K04513  Ras homolog gene family, member A
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04144  Endocytosis
sgh04150  mTOR signaling pathway
sgh04270  Vascular smooth muscle contraction
sgh04310  Wnt signaling pathway
sgh04350  TGF-beta signaling pathway
sgh04510  Focal adhesion
sgh04520  Adherens junction
sgh04530  Tight junction
sgh04621  NOD-like receptor signaling pathway
sgh04625  C-type lectin receptor signaling pathway
sgh04810  Regulation of actin cytoskeleton
sgh05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107558917
   04350 TGF-beta signaling pathway
    107558917
   04150 mTOR signaling pathway
    107558917
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107558917
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107558917
   04520 Adherens junction
    107558917
   04530 Tight junction
    107558917
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107558917
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    107558917
   04625 C-type lectin receptor signaling pathway
    107558917
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107558917
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107558917
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sgh04131]
    107558917
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sgh04147]
    107558917
   04031 GTP-binding proteins [BR:sgh04031]
    107558917
Membrane trafficking [BR:sgh04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    107558917
Exosome [BR:sgh04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107558917
  Exosomal proteins of other body fluids (saliva and urine)
   107558917
  Exosomal proteins of colorectal cancer cells
   107558917
  Exosomal proteins of bladder cancer cells
   107558917
GTP-binding proteins [BR:sgh04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    107558917
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB
Other DBs
NCBI-GeneID: 107558917
NCBI-ProteinID: XP_016098106
UniProt: A0A672PSB7
LinkDB
Position
Unknown
AA seq 193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKPEEARDMANRINAFGYLECSAKTKDGVREVFEMATRAALQ
AKKRGKKSGCLLL
NT seq 582 nt   +upstreamnt  +downstreamnt
atggctgccattcgtaagaaactggttatagtgggcgatggagcctgtggaaagacctgc
ttgcttattgttttcagtaaagatcagtttcctgaagtctacgtgcccacagtgtttgag
aactatgttgcagacattgaggtcgatggaaaacaggtagagcttgccttatgggatacg
gctggacaggaggactatgatcggttaagacctctctcctaccctgacacagatgtcatt
cttatgtgcttctccattgacagtcccgatagcttggagaatattccagaaaagtggaca
ccagaggtgaagcatttctgtccgaatgttcccatcatcctcgttggtaacaaaaaggat
ctccgaaatgatgagcacacacgaagggaacttgccaaaatgaaacaggagcctgtgaag
ccagaggaggcacgagacatggccaaccgaatcaacgcctttggttatttagaatgctca
gccaagacaaaagatggcgtgagggaggtgttcgagatggccaccagggctgcgctgcaa
gcgaagaaacggggcaaaaagtctggctgtctgctgttatag

KEGG   Sinocyclocheilus grahami: 107562777
Entry
107562777         CDS       T04918                                 

Definition
(RefSeq) rho-related GTP-binding protein RhoA-D-like isoform X1
  KO
K04513  Ras homolog gene family, member A
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04144  Endocytosis
sgh04150  mTOR signaling pathway
sgh04270  Vascular smooth muscle contraction
sgh04310  Wnt signaling pathway
sgh04350  TGF-beta signaling pathway
sgh04510  Focal adhesion
sgh04520  Adherens junction
sgh04530  Tight junction
sgh04621  NOD-like receptor signaling pathway
sgh04625  C-type lectin receptor signaling pathway
sgh04810  Regulation of actin cytoskeleton
sgh05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107562777
   04350 TGF-beta signaling pathway
    107562777
   04150 mTOR signaling pathway
    107562777
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107562777
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107562777
   04520 Adherens junction
    107562777
   04530 Tight junction
    107562777
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107562777
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    107562777
   04625 C-type lectin receptor signaling pathway
    107562777
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107562777
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107562777
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sgh04131]
    107562777
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sgh04147]
    107562777
   04031 GTP-binding proteins [BR:sgh04031]
    107562777
Membrane trafficking [BR:sgh04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    107562777
Exosome [BR:sgh04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107562777
  Exosomal proteins of other body fluids (saliva and urine)
   107562777
  Exosomal proteins of colorectal cancer cells
   107562777
  Exosomal proteins of bladder cancer cells
   107562777
GTP-binding proteins [BR:sgh04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    107562777
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA
Other DBs
NCBI-GeneID: 107562777
NCBI-ProteinID: XP_016102984
LinkDB
Position
Unknown
AA seq 194 aa
MMAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWD
TAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKK
DLRNDEHTRRELIKMKQEPVKPEEGRDMANRISAFGCLECSAKTKEGVREVFEMATRAAL
QVRKRKKRSGCLLL
NT seq 585 nt   +upstreamnt  +downstreamnt
atgatggcagctatccgtaagaagctggtgattgtgggagatggagcctgtgggaaaacc
tgcttgctgattgtgttcagtaaagatcagttccccgaggtctacgtgcccacagtgttt
gaaaactacatcgctgacatagaggtggatggcaaacaggtggagttggctctatgggat
acagctggtcaggaagactatgatcgtttgaggccattgtcgtatccagacacggatgtt
attctgatgtgcttctctatagatagtccagatagtttagagaatattccagagaaatgg
acgccagaggtaaaacatttctgccccaacgttcccatcatccttgttggcaataaaaag
gacctgcggaatgatgaacacacgcgcagggagctgatcaagatgaaacaggaacctgta
aaacctgaggagggccgtgacatggctaacaggatcagtgcgtttggatgtttagagtgt
tcggctaaaactaaagagggagtgcgggaggtgtttgagatggccaccagggcggcgctg
caggtccgcaagcgcaagaagagaagcggctgcctgctgttatga

KEGG   Sinocyclocheilus grahami: 107569805
Entry
107569805         CDS       T04918                                 

Definition
(RefSeq) rho-related GTP-binding protein RhoA-D
  KO
K04513  Ras homolog gene family, member A
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04144  Endocytosis
sgh04150  mTOR signaling pathway
sgh04270  Vascular smooth muscle contraction
sgh04310  Wnt signaling pathway
sgh04350  TGF-beta signaling pathway
sgh04510  Focal adhesion
sgh04520  Adherens junction
sgh04530  Tight junction
sgh04621  NOD-like receptor signaling pathway
sgh04625  C-type lectin receptor signaling pathway
sgh04810  Regulation of actin cytoskeleton
sgh05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107569805
   04350 TGF-beta signaling pathway
    107569805
   04150 mTOR signaling pathway
    107569805
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107569805
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107569805
   04520 Adherens junction
    107569805
   04530 Tight junction
    107569805
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107569805
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    107569805
   04625 C-type lectin receptor signaling pathway
    107569805
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107569805
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107569805
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sgh04131]
    107569805
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sgh04147]
    107569805
   04031 GTP-binding proteins [BR:sgh04031]
    107569805
Membrane trafficking [BR:sgh04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    107569805
Exosome [BR:sgh04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107569805
  Exosomal proteins of other body fluids (saliva and urine)
   107569805
  Exosomal proteins of colorectal cancer cells
   107569805
  Exosomal proteins of bladder cancer cells
   107569805
GTP-binding proteins [BR:sgh04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    107569805
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA
Other DBs
NCBI-GeneID: 107569805
NCBI-ProteinID: XP_016111448
UniProt: A0A672MNL5
LinkDB
Position
Unknown
AA seq 193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDSKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDDHTRRELTKMKQEPVKPEEGRDMANRISAFGYLECSAKTKDGVREVFEMATRAALQ
VRKRKKRSGCLLL
NT seq 582 nt   +upstreamnt  +downstreamnt
atggcagctatcaggaaaaagctggtgatcgtgggagatggagcgtgtgggaagacctgt
ctcctcatagtgttcagcaaagaccagtttccagaagtctatgtgcctactgtgttcgag
aactacattgcagacatcgaagtcgacagcaaacaggtggagctggcattgtgggacaca
gcaggacaggaagactacgatcgtctgaggcctctgtcttatccagacacagatgtcatc
ctcatgtgtttctcaatagacagtcccgacagcttagagaatatcccagaaaagtggaca
ccggaggtgaagcacttctgcccaaacgttcccataatcctcgtgggcaataagaaggat
ctgcggaatgatgaccacacacggagagagctgactaagatgaagcaggagccagttaaa
ccggaggagggcagggacatggccaatcgcattagcgccttcggctacctggaatgctca
gctaagacgaaggatggcgtgagggaagtattcgaaatggccaccagggcggcgctgcaa
gtccgcaagaggaagaagaggagcggctgcttgctgctgtga

KEGG   Sinocyclocheilus grahami: 107571578
Entry
107571578         CDS       T04918                                 

Definition
(RefSeq) rho-related GTP-binding protein RhoA-D-like
  KO
K04513  Ras homolog gene family, member A
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04144  Endocytosis
sgh04150  mTOR signaling pathway
sgh04270  Vascular smooth muscle contraction
sgh04310  Wnt signaling pathway
sgh04350  TGF-beta signaling pathway
sgh04510  Focal adhesion
sgh04520  Adherens junction
sgh04530  Tight junction
sgh04621  NOD-like receptor signaling pathway
sgh04625  C-type lectin receptor signaling pathway
sgh04810  Regulation of actin cytoskeleton
sgh05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107571578
   04350 TGF-beta signaling pathway
    107571578
   04150 mTOR signaling pathway
    107571578
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107571578
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107571578
   04520 Adherens junction
    107571578
   04530 Tight junction
    107571578
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107571578
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    107571578
   04625 C-type lectin receptor signaling pathway
    107571578
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107571578
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107571578
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sgh04131]
    107571578
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sgh04147]
    107571578
   04031 GTP-binding proteins [BR:sgh04031]
    107571578
Membrane trafficking [BR:sgh04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    107571578
Exosome [BR:sgh04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107571578
  Exosomal proteins of other body fluids (saliva and urine)
   107571578
  Exosomal proteins of colorectal cancer cells
   107571578
  Exosomal proteins of bladder cancer cells
   107571578
GTP-binding proteins [BR:sgh04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    107571578
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB
Other DBs
NCBI-GeneID: 107571578
NCBI-ProteinID: XP_016113398
UniProt: A0A672PL80
LinkDB
Position
Unknown
AA seq 193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRHDEHTRCELFKMKQEPVKPEEGRDMANRICAFGYMECSAKSKDGVREVFEMATRAALQ
ARKGKKSSKCLLL
NT seq 582 nt   +upstreamnt  +downstreamnt
atggcggcgatccgtaagaagctggtgatcgtgggcgacggcgcgtgcgggaagacctgc
ctgctcatcgtcttcagcaaagaccagttccccgaggtctacgtgcccaccgtcttcgag
aactacgtggccgacatcgaggtggacagcaagcaggtggagctagcgctgtgggacacg
gcgggtcaggaggactacgaccgtctgcggccgctctcttaccccgacaccgacgtcatc
ctcatgtgcttctccatcgacagccccgacagcctggagaacattcccgagaaatggact
ccggaggtcaagcacttctgccccaacgttcccataatcctggtgggcaacaagaaggac
ctgcgccacgacgaacacactcgctgcgagctcttcaagatgaagcaggagcccgtcaag
ccggaggagggccgagacatggccaaccgcatctgtgccttcggatacatggagtgctcc
gccaaaagcaaggacggcgtgcgggaggtgtttgagatggccaccagggcggcgctgcag
gcacgcaagggcaagaagagcagcaaatgcctgctgctgtag

KEGG   Sinocyclocheilus grahami: 107579050
Entry
107579050         CDS       T04918                                 

Definition
(RefSeq) transforming protein RhoA-like
  KO
K04513  Ras homolog gene family, member A
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04144  Endocytosis
sgh04150  mTOR signaling pathway
sgh04270  Vascular smooth muscle contraction
sgh04310  Wnt signaling pathway
sgh04350  TGF-beta signaling pathway
sgh04510  Focal adhesion
sgh04520  Adherens junction
sgh04530  Tight junction
sgh04621  NOD-like receptor signaling pathway
sgh04625  C-type lectin receptor signaling pathway
sgh04810  Regulation of actin cytoskeleton
sgh05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107579050
   04350 TGF-beta signaling pathway
    107579050
   04150 mTOR signaling pathway
    107579050
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107579050
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107579050
   04520 Adherens junction
    107579050
   04530 Tight junction
    107579050
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107579050
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    107579050
   04625 C-type lectin receptor signaling pathway
    107579050
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107579050
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107579050
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sgh04131]
    107579050
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sgh04147]
    107579050
   04031 GTP-binding proteins [BR:sgh04031]
    107579050
Membrane trafficking [BR:sgh04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    107579050
Exosome [BR:sgh04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107579050
  Exosomal proteins of other body fluids (saliva and urine)
   107579050
  Exosomal proteins of colorectal cancer cells
   107579050
  Exosomal proteins of bladder cancer cells
   107579050
GTP-binding proteins [BR:sgh04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    107579050
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA
Other DBs
NCBI-GeneID: 107579050
NCBI-ProteinID: XP_016120419
LinkDB
Position
Unknown
AA seq 174 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENITEKWTPEVKHLCPSVPIILVGNKKD
LRNDEHTRRELAKMKQAGPFYFVKCMILKGIVHPKMKICRKCSPSQVIQDIDEF
NT seq 522 nt   +upstreamnt  +downstreamnt
atggctgccattcgtaagaagctcgtcatagtgggcgatggagcctgtggaaagacctgc
ttgcttattgttttcagtaaagatcagtttcctgaagtctacgtgcccacagtgtttgag
aactatgttgcagacatcgaggtcgatggaaaacaggtggagcttgccttatgggataca
gctggacaggaggactatgatcggttaagacctctctcctaccccgacacagatgtcatt
cttatgtgcttttccatcgacagtcccgatagcttggagaatattacagaaaagtggaca
ccagaggtgaagcatctctgtccgagtgttcccatcatcctcgttggtaacaaaaaggat
ctccgaaacgatgagcacacacgaagggaacttgccaaaatgaaacaggcagggcctttt
tactttgtaaaatgtatgattcttaaaggaatagttcacccaaaaatgaaaatttgccga
aaatgttctccctctcaagtcatccaagatatagatgaattt

KEGG   Sinocyclocheilus grahami: 107591763
Entry
107591763         CDS       T04918                                 

Definition
(RefSeq) rho-related GTP-binding protein RhoA-D-like
  KO
K04513  Ras homolog gene family, member A
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04144  Endocytosis
sgh04150  mTOR signaling pathway
sgh04270  Vascular smooth muscle contraction
sgh04310  Wnt signaling pathway
sgh04350  TGF-beta signaling pathway
sgh04510  Focal adhesion
sgh04520  Adherens junction
sgh04530  Tight junction
sgh04621  NOD-like receptor signaling pathway
sgh04625  C-type lectin receptor signaling pathway
sgh04810  Regulation of actin cytoskeleton
sgh05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107591763
   04350 TGF-beta signaling pathway
    107591763
   04150 mTOR signaling pathway
    107591763
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107591763
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107591763
   04520 Adherens junction
    107591763
   04530 Tight junction
    107591763
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107591763
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    107591763
   04625 C-type lectin receptor signaling pathway
    107591763
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107591763
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107591763
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sgh04131]
    107591763
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sgh04147]
    107591763
   04031 GTP-binding proteins [BR:sgh04031]
    107591763
Membrane trafficking [BR:sgh04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    107591763
Exosome [BR:sgh04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107591763
  Exosomal proteins of other body fluids (saliva and urine)
   107591763
  Exosomal proteins of colorectal cancer cells
   107591763
  Exosomal proteins of bladder cancer cells
   107591763
GTP-binding proteins [BR:sgh04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    107591763
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA VASP_tetra
Other DBs
NCBI-GeneID: 107591763
NCBI-ProteinID: XP_016136486
UniProt: A0A672P7I2
LinkDB
Position
Unknown
AA seq 193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDSKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELSKMKQEPVKPEEGRDMANRISAFGYLECSAKTKDGVREVFEMATRAALQ
VRKRKKRGGCLLL
NT seq 582 nt   +upstreamnt  +downstreamnt
atggcagctatccgtaagaagctggtgattgtgggagatggagcctgtgggaaaacctgc
ttgctgattgtgttcagtaaagatcagttccccgaggtctacgtgcctacagtgtttgaa
aattacatcgctgatatagaggtggacagcaaacaggtggagttggctctatgggacaca
gctggtcaggaagactatgatcggttaaggccattgtcatatcctgacacggatgttatt
ctgatgtgtttctctatagacagtccagatagtttagaaaatattccagagaaatggacg
ccagaggtaaaacatttctgtcccaacgttcccatcatccttgtgggcaataaaaaggac
ctgcggaatgatgaacacacacgcagggagctgagtaagatgaaacaggaacctgtaaaa
ccagaggagggccgtgacatggctaacaggatcagtgcatttggatatttagagtgttcg
gctaaaactaaagatggagtgcgggaagtgtttgagatggccaccagggcggcactgcag
gtccgcaagcgcaagaagagaggcggctgcctgctgttataa

KEGG   Sinocyclocheilus grahami: 107591788
Entry
107591788         CDS       T04918                                 

Definition
(RefSeq) rho-related GTP-binding protein RhoA-B
  KO
K04513  Ras homolog gene family, member A
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04144  Endocytosis
sgh04150  mTOR signaling pathway
sgh04270  Vascular smooth muscle contraction
sgh04310  Wnt signaling pathway
sgh04350  TGF-beta signaling pathway
sgh04510  Focal adhesion
sgh04520  Adherens junction
sgh04530  Tight junction
sgh04621  NOD-like receptor signaling pathway
sgh04625  C-type lectin receptor signaling pathway
sgh04810  Regulation of actin cytoskeleton
sgh05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107591788
   04350 TGF-beta signaling pathway
    107591788
   04150 mTOR signaling pathway
    107591788
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107591788
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107591788
   04520 Adherens junction
    107591788
   04530 Tight junction
    107591788
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107591788
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    107591788
   04625 C-type lectin receptor signaling pathway
    107591788
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107591788
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107591788
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sgh04131]
    107591788
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sgh04147]
    107591788
   04031 GTP-binding proteins [BR:sgh04031]
    107591788
Membrane trafficking [BR:sgh04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    107591788
Exosome [BR:sgh04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107591788
  Exosomal proteins of other body fluids (saliva and urine)
   107591788
  Exosomal proteins of colorectal cancer cells
   107591788
  Exosomal proteins of bladder cancer cells
   107591788
GTP-binding proteins [BR:sgh04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    107591788
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra
Other DBs
NCBI-GeneID: 107591788
NCBI-ProteinID: XP_016136529
UniProt: A0A672PBR1
LinkDB
Position
Unknown
AA seq 193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELTKMKQEPVKAEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
ARRGKKSNKCSLL
NT seq 582 nt   +upstreamnt  +downstreamnt
atggcagcaattcgcaagaagctggtgattgtaggagatggagcgtgcggtaaaacctgt
ttgcttattgtgttcagtaaagaccagtttcccgaagtctatgtccccacggtgtttgag
aactatgtcgccgacattgaggttgacagcaaacaggtggaacttgctctttgggatacc
gcaggacaggaggactacgataggctccgtccgctttcgtacccagacactgatgtcatt
cttatgtgcttttctattgatagtcctgacagtttagagaatattccagagaagtggaca
cccgaggtgaaacacttttgcccaaacgttcccatcatccttgtcggcaacaaaaaggac
ctgcggaatgatgaacacacacgcagggagctgaccaagatgaagcaggagcctgttaag
gcagaggaagggagagacatggccaatcggattggagcatttggttatatggagtgctca
gccaaaacaaaagatggcgttcgggaggtgtttgaaatggccactagagcggcgttgcag
gcacgcaggggaaagaagagcaacaaatgcagtctgctgtga

KEGG   Sinocyclocheilus grahami: 107599000
Entry
107599000         CDS       T04918                                 

Definition
(RefSeq) rho-related GTP-binding protein RhoA-A-like
  KO
K04513  Ras homolog gene family, member A
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04144  Endocytosis
sgh04150  mTOR signaling pathway
sgh04270  Vascular smooth muscle contraction
sgh04310  Wnt signaling pathway
sgh04350  TGF-beta signaling pathway
sgh04510  Focal adhesion
sgh04520  Adherens junction
sgh04530  Tight junction
sgh04621  NOD-like receptor signaling pathway
sgh04625  C-type lectin receptor signaling pathway
sgh04810  Regulation of actin cytoskeleton
sgh05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107599000
   04350 TGF-beta signaling pathway
    107599000
   04150 mTOR signaling pathway
    107599000
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107599000
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107599000
   04520 Adherens junction
    107599000
   04530 Tight junction
    107599000
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107599000
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    107599000
   04625 C-type lectin receptor signaling pathway
    107599000
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107599000
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107599000
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sgh04131]
    107599000
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sgh04147]
    107599000
   04031 GTP-binding proteins [BR:sgh04031]
    107599000
Membrane trafficking [BR:sgh04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    107599000
Exosome [BR:sgh04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107599000
  Exosomal proteins of other body fluids (saliva and urine)
   107599000
  Exosomal proteins of colorectal cancer cells
   107599000
  Exosomal proteins of bladder cancer cells
   107599000
GTP-binding proteins [BR:sgh04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    107599000
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra
Other DBs
NCBI-GeneID: 107599000
NCBI-ProteinID: XP_016145969
LinkDB
Position
Unknown
AA seq 251 aa
MFCSEGLLAFGRHSSVSASDWWKRREWACLSGVAPSAGRGLGVVQEKIKKARTSERKTMA
AIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDTAG
QEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLR
NDDHTRRELQKMKQEPVKPEEGRDMANRINAFGYLECSAKTKDGVREVFEMATRAALQAK
KRGKKNPCALL
NT seq 756 nt   +upstreamnt  +downstreamnt
atgttctgcagtgaggggctgctggcttttggacgtcactccagcgtctctgcctctgat
tggtggaaacgacgagaatgggcgtgtcttagcggcgtggcaccgtctgcggggcggggc
cttggggtcgtacaggaaaagataaagaaagcgaggacatctgaaagaaaaacgatggct
gcaattcgtaagaagcttgtaatcgttggggatggagcatgtggaaagacgtgtttactc
atcgttttcagtaaagaccagtttcctgaggtctacgtacccacagtgttcgagaactat
gttgctgatattgaggtggacagcaaacaggtggaactggctctatgggatacagctgga
caagaggactacgacaggctgaggcccctgtcctacccagacactgatgtcatcctcatg
tgcttttccgtagacagccctgacagtttggagaatatcccagaaaaatggacgccggag
gtaaaacatttctgtccaaatgtgccaataattctggtgggtaataaaaaagatttacgg
aatgatgatcacactcgacgggagctgcagaagatgaaacaggaaccagttaaaccagag
gaagggcgagacatggctaatcgcatcaatgccttcggctaccttgagtgttcggctaaa
actaaggatggcgtgagggaagtgtttgaaatggccacaagagcggcgctccaagccaaa
aaacgtggcaagaagaatccctgtgctttgctatag

KEGG   Sinocyclocheilus grahami: 107603137
Entry
107603137         CDS       T04918                                 

Definition
(RefSeq) rho-related GTP-binding protein RhoA-A
  KO
K04513  Ras homolog gene family, member A
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04144  Endocytosis
sgh04150  mTOR signaling pathway
sgh04270  Vascular smooth muscle contraction
sgh04310  Wnt signaling pathway
sgh04350  TGF-beta signaling pathway
sgh04510  Focal adhesion
sgh04520  Adherens junction
sgh04530  Tight junction
sgh04621  NOD-like receptor signaling pathway
sgh04625  C-type lectin receptor signaling pathway
sgh04810  Regulation of actin cytoskeleton
sgh05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107603137
   04350 TGF-beta signaling pathway
    107603137
   04150 mTOR signaling pathway
    107603137
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107603137
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107603137
   04520 Adherens junction
    107603137
   04530 Tight junction
    107603137
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107603137
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    107603137
   04625 C-type lectin receptor signaling pathway
    107603137
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107603137
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107603137
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sgh04131]
    107603137
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sgh04147]
    107603137
   04031 GTP-binding proteins [BR:sgh04031]
    107603137
Membrane trafficking [BR:sgh04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    107603137
Exosome [BR:sgh04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107603137
  Exosomal proteins of other body fluids (saliva and urine)
   107603137
  Exosomal proteins of colorectal cancer cells
   107603137
  Exosomal proteins of bladder cancer cells
   107603137
GTP-binding proteins [BR:sgh04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    107603137
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA
Other DBs
NCBI-GeneID: 107603137
NCBI-ProteinID: XP_016151340
UniProt: A0A672K128
LinkDB
Position
Unknown
AA seq 193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDDHTRREMLKMKQEPVKPEEGRDMANRINAFGYLECSAKTKDGVREVFEMATRAALQ
AKKRGKKNPCALL
NT seq 582 nt   +upstreamnt  +downstreamnt
atggctgcaattcgtaagaagcttgtaatcgttggggatggagcatgtggaaagacgtgt
ttactcatcgttttcagtaaagaccagtttcctgaggtctacgtacccacagtgttcgag
aactatgttgctgatatcgaggtggacggcaaacaggtggaactggctctatgggataca
gctggacaagaggactacgacaggctgaggcccctgtcctacccagacactgatgtcatc
ctcatgtgcttttccatagacagccctgacagtttggagaatatcccagaaaaatggacg
ccggaggtaaaacatttctgtccaaatgttccaataattctggtgggtaataaaaaagat
ttacggaatgatgatcacactcgacgggagatgctgaagatgaaacaggaaccagttaaa
ccagaggaaggacgagacatggctaatcgcatcaatgccttcggctaccttgagtgttcg
gctaaaactaaggatggtgtgagggaagtgttcgaaatggccacaagagcggcgctccaa
gccaaaaagcgtggcaagaagaatccctgcgctttgctatag

DBGET integrated database retrieval system