KEGG   Sinocyclocheilus grahami: 107549565
Entry
107549565         CDS       T04918                                 

Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1D-like isoform X1
  KO
K04851  voltage-dependent calcium channel L type alpha-1D
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04020  Calcium signaling pathway
sgh04218  Cellular senescence
sgh04260  Cardiac muscle contraction
sgh04261  Adrenergic signaling in cardiomyocytes
sgh04270  Vascular smooth muscle contraction
sgh04530  Tight junction
sgh04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107549565
   04020 Calcium signaling pathway
    107549565
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    107549565
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107549565
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    107549565
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107549565
   04261 Adrenergic signaling in cardiomyocytes
    107549565
   04270 Vascular smooth muscle contraction
    107549565
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:sgh04040]
    107549565
Ion channels [BR:sgh04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107549565
SSDB
Motif
Pfam: Ion_trans CAC1F_C Ca_chan_IQ GPHH PKD_channel Rer1
Other DBs
NCBI-GeneID: 107549565
NCBI-ProteinID: XP_016086177
LinkDB
Position
Unknown
AA seq 2083 aa
MDEPEEPTEGANYASGSRAPVSSDAPPVRSETPPITSHHSPAQSAALSWQAAINAARQSQ
GTPKTMNFSAAASTAPAGSLAQRKRQQYAKSKKQGSTTNSRPPRALFCLTLNNPVRRACI
NLVEWKPFDIFILLSIFANCVALAVYIPFPEDDSNSTNHDLETVEYAFLIIFTIETFLKI
IAYGLVMHQNSYVRNGWNMMDFVIVIVGLFSVVLELVTKDRDVSGQSGGKPGGFDVKALR
AFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHAT
CYLNDTRTLAEEDPGPCSLSGHGRHCPLSGTVCRDGWHGPNNGITNFDNFLFAMLTVFQC
ITMEGWTDVLYWMNDAMGSELPWVYFVTLVIFGSFFVLNLVLGVLSGEFSKEREKAKARG
DFQKLREKQQLEEDLKGYLDWITQAEDIDPDNDEEGDQEAKRNRVTLGDLTHRKNKGNSG
WFSQSTETHESIPTSETESVNTENPGEDEKVCCGPICQKLTKSKFSRWRCWNRFCRRKCR
AVVKSTIFYWLVILLVFLNTLTISSEHYNQPDWLTEVQDVANKVLLALFTCEMLVKMYSL
GLQAYFVSLFNRFDCFVVCGGIVETILVELEIMSPLGISVFRCVRLLRIFKVTRHWASLS
NLVASLLNSMKSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDETVTKRSTFDNFPQALLT
VFQILTGEDWNTVMYDGIMAYGGPSSSGMLVCIYFIILFICGNYILLNVFLAIAVDNLAD
AESLNSAQKEEEKRNKRKKNRSMSIYKRDGDDGNLKASGDQEGNQDQTEDMTDSSEEDEE
EEPEVPSGPRPQRLSELNLREKTPPIPEGSAFFILSNTNPIRVACHRLINHQIFTNLILI
FIMLSSVSLAAEDPIRNFSARNIVLGYFDYAFTAIFTVEILLKMTAFGAFLHKGAFCRNY
FNLLDLLVVGVSLVSFGIQSSAISVVKILRILRVLRPLRAINRAKGLKHVVQCVFVAIRT
IGNIMIVTTLLQFLFACIGVQLFKGKFYRCSDDAKTSPEDCRGTFIVYSIGEMALPQMRE
RIWYNSDFNFDNVLMAMMALFTVSTFEGWPALLYKAIDSNKENMGPIYNYRVEISIFFII
YIIIIAFFMMNIFVGFVIVTFQEQGEKEYKNCELDKNQRQCVEYALKARPLRRYIPKNPY
QYKFWYVVNSTGFEYVMFVLIVLNTLCLAVQHHGQSRLFNYGMDILNMVFTGVFAVEMIL
KLVAFKPKHYFADAWNTFDALIVVGSIVDIAITEINNTEDSARISITFFRLFRVMRLVKL
LSRGEGIRTLLWTFIKSFQALPYVALLIAMLFFIYAVIGMQVFGKIAMVDGTSINRNNNF
QTFPQAVLLLFRCATGEAWQLIMLACLPGKQCDSESDYNPGEEKTCGSNFAILYFISFYM
LCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWSEYDPEAKGRIKHLDVVTLL
RRIQPPLGFGKLCPHRVACKRLVAMNMPLNSDGTVMFNATLFALVRTALKIKTEGNMEQA
NEELRAVIKKIWKRTSMKLLDQVVPPAGDDDITVGKFYATFLIQDYFRKFRKRKEQGLVG
CQPYLNTTTALQAGLRTLHDIGPEIRRAISCDLQDEGLVDVNLHEEEEIYERNGVVFGNH
VSGDQYGSVTQRPLQLPLPLCSTQNYCPSMSDKSSNSNINNANMPAVTAFPNGWHSRCRR
LSGTLVSSLSSYLNLRSDGEPQLRTHSRRPDTTAVGYPIIHVETSTLGDISNDDRNSGEY
YSGDEFNEDGVMLATDRSYFQDTLIDGTPAGQQDVCECVCDDGEHLISQQSQRSSKRLLL
STAQSSHKSAFHFECLRKQNSQDEIPLRPTGLPQHQVKMPTGQESSRTRLSPTRSIRSWV
TPPATPPSYTPLIQTTPSASSTPGLVHRGFWNSQQASDWSTRSPSPSFLKVPPRLCGHHL
QQRSSAQSLVEAVMISGGLGKYAKDPKFVTVTKHEIADACEMTIDEMESAASNLLNVTLG
RGPETDEAGLCQNNLRDYSDEEMDTSNKCEEDLADEMIYVSVL
NT seq 6252 nt   +upstreamnt  +downstreamnt
atggacgagccagaggaaccgactgaaggggcaaactatgccagtggcagcagagccccc
gtctctagtgatgcccctcccgtccggtcagaaacgccgccaatcaccagccatcattca
ccggcccagtccgccgcgctctcctggcaggccgcgattaatgcagccagacagtctcag
ggcacccccaaaaccatgaacttctctgctgctgcaagcactgctccagccggctcgctc
gcccagaggaaacgccagcaatatgccaaaagcaagaaacagggaagcaccactaatagc
agacctccaagagcacttttctgcctgactctcaataaccctgtgcgcagagcgtgcatt
aacttagtggagtggaaaccttttgatatctttatactgctgtcaatatttgccaactgt
gtggccttagctgtttacatcccctttcctgaagacgattccaactcaactaatcatgat
ttggaaacagtagaatatgccttcctgattattttcacgattgaaaccttcctcaagatc
atagcttatggacttgtgatgcaccagaactcctatgtgagaaacggctggaatatgatg
gattttgtcatcgtcattgtaggtctcttcagtgtcgtgctggagctggtaaccaaagat
cgagatgtcagcgggcagtcaggtgggaagccgggcgggtttgatgtcaaggctttacga
gcgttcagagttctgcggcccctccgcctggtctcaggagtgccaagcttacaggtagtg
ctgaactccattattaaggccatggttcctctgctgcacattgctctgctcgtactcttc
gtcatcatcatctatgccatcatcggactggagctgttcatcgggaagatgcatgcgacc
tgctatctgaatgacacgcgtacattagcagaggaggatcccggtccctgttctctttct
ggtcatgggcgtcactgccctctcagtggcaccgtgtgtagggatggttggcatggaccc
aacaacggcatcacaaactttgacaacttcctgtttgccatgctgactgtgttccagtgt
atcaccatggagggctggactgatgtgctgtactggatgaatgatgctatgggctctgag
ttgccttgggtctattttgtcactctggtcatttttggctccttctttgtcctcaatcta
gtattgggcgttctcagtggagagttctctaaggagcgtgagaaggccaaagctcgtgga
gatttccagaaactgcgtgagaagcagcagcttgaggaggatctgaagggctatctggat
tggatcacacaagctgaggacatcgaccctgataatgatgaggagggagatcaagaggcc
aaacgcaaccgggtgacactgggcgatctcacccacaggaagaacaaaggaaactcgggc
tggttcagtcagtccactgagacgcatgaaagtatccccacaagtgagacagagtctgtg
aacacagagaacccaggagaagatgagaaagtctgctgtgggcccatctgtcagaaattg
acaaagtcgaagttcagccgctggcgttgctggaacagattttgtcgccggaagtgccga
gctgttgtgaaatccaccatcttctattggctggtgattctgctggtgttcctcaataca
ctcacaatatcatccgaacattataaccagcccgactggctcacggaagtccaggatgtg
gctaataaggtgttgttagccctgttcacatgcgagatgctagtaaaaatgtacagtctg
ggactacaggcatactttgtgtcgcttttcaaccgcttcgactgctttgtagtttgtgga
ggcatagtggagacgatcctcgtggagcttgagatcatgtctcctctcggcatctctgtg
tttcgctgcgtccggctcctcagaatctttaaagtcacacgtcactgggcgtctctgagt
aacctggtggcatcacttttgaactccatgaagtccattgcatccctactgctgttgctc
ttcctcttcatcattatcttcagtttgcttggcatgcagctcttcggaggaaagttcaac
tttgatgagactgttaccaaacgaagcacttttgacaactttcctcaagccctgctgact
gtctttcagatcctgacgggtgaggattggaatacagtgatgtatgatgggatcatggcg
tatggaggcccctcctcctcaggcatgcttgtgtgcatctacttcatcatcctcttcatc
tgtggaaactacatcttactgaacgtattcttggccattgctgtggataacctggcagat
gctgaaagtctgaactcagcccagaaagaggaagagaagaggaacaagaggaagaaaaac
aggagtatgagcatatacaagagagatggtgacgatggaaacttaaaggcatctggtgat
caggaaggtaatcaggatcagacagaagacatgactgactcctcagaggaggatgaggag
gaagagcctgaggtaccgtcagggccgcggccccagagattgtcagagctgaacctcaga
gaaaagacgccacccatcccagagggcagcgccttcttcatccttagcaacaccaacccg
atccgtgtggcgtgccatcggctcatcaatcatcagatcttcaccaacctcatcctcatc
ttcatcatgctgagctccgtctcgctggcagccgaggaccccatccgtaacttctctgca
cgaaacattgttcttggttattttgactatgccttcactgctatatttactgtggagatc
ttgctgaagatgactgcgtttggtgctttccttcacaaaggagctttctgcagaaattac
tttaatttgctggatctgctggtggttggagtctcccttgtttccttcggcatacaatcg
tcagctatttcagtggtgaagatcttaaggattctgcgtgtgcttcgacctctgagagcc
atcaacagagccaaaggactcaaacatgtggttcagtgtgtatttgtggccatcaggacg
attgggaacatcatgattgtcaccacacttcttcagttcttgtttgcctgtatcggtgtg
cagctgtttaaggggaaattctaccgctgttctgatgatgcaaaaacaagtccagaggac
tgcagagggacgtttatcgtgtacagtattggcgagatggcactgccacaaatgcgtgag
aggatctggtacaacagtgactttaactttgataatgtgctgatggctatgatggccctc
ttcaccgtctcaacgtttgagggctggccagccctgctgtacaaggccatcgactcaaac
aaggaaaacatgggtcccatctacaactaccgcgtggagatctccatcttcttcatcatc
tacatcatcatcatcgccttcttcatgatgaacatttttgtgggttttgtcattgtcacg
tttcaggagcagggcgagaaagagtacaagaactgtgagctggacaagaaccagcgccag
tgtgtggagtacgctctgaaagcccgtccgctgaggagatacatccctaaaaacccgtac
cagtataagttctggtatgtggtgaactccacgggctttgagtatgtcatgtttgtgctc
atcgtcctcaacacactgtgtctggccgttcagcatcacggccagtcacgtcttttcaat
tatgggatggacattttgaacatggtgttcacgggtgtctttgcagtcgaaatgattctc
aaactggttgccttcaaaccaaagcactattttgccgatgcatggaacacgtttgatgcc
ttaattgttgttggtagcatcgttgacattgcaatcacagagatcaataacacggaagac
agcgcaagaatttccatcacattcttccgtctgtttcgtgtcatgcgcttagtgaagttg
ttgagcagaggagagggcattcgtacgctcctctggaccttcatcaaatcatttcaggct
cttccgtatgtggctctgcttattgccatgttgttcttcatctatgctgtcattggaatg
caggtgtttgggaagatcgccatggtggatggaaccagtattaatcgtaacaataatttc
cagacctttccacaagctgtgcttctgctgttcagatgtgcgacaggtgaggcatggcag
ctgatcatgttggcgtgtttgcctggcaaacagtgtgactctgagtccgactataaccct
ggagaagagaaaacctgcggcagcaactttgctatcctctacttcatcagcttctacatg
ctctgtgcttttctgatcattaatctgtttgtcgctgtcatcatggacaactttgactac
ttgacacgtgattggtcgattcttggaccacatcatttagatgaattcaagaggatttgg
tcggaatatgatcctgaggccaagggccgtataaaacacttagatgtggtgacgttactg
cgcaggattcagccgccgctgggctttggcaagctgtgtcctcatagagtggcttgcaag
aggttggttgccatgaacatgccactaaatagcgacggtacggtcatgttcaatgccaca
ctgttcgctctggttagaactgctctgaaaatcaagaccgaagggaatatggaacaagcc
aatgaggagttacgagccgtcatcaagaagatctggaagagaaccagcatgaaactcctg
gaccaagtagtgccacctgctggagatgatgacatcactgtggggaagttctatgccact
ttcctgatacaggactacttcaggaaattcaggaaacgtaaagaacaaggtcttgtggga
tgccaaccctatttaaacaccactaccgccctgcaggctggtctgcgcacactgcatgat
atcggccctgagatccgtcgagccatatcatgtgatctacaggatgaaggtctagtagac
gtcaacctccacgaggaggaagagatatacgaaaggaatggggttgtgtttgggaatcat
gtgagtggagatcagtacggcagcgtcacacagcgtcctctgcagctcccgcttcctctg
tgctccacccaaaattactgtccgtcgatgtcagacaaatcatccaactccaatatcaac
aatgccaacatgccagcggtcactgcctttcccaacggctggcacagtcgctgccggcgg
ctctctgggaccctggtgtcctctctgagctcctacctcaacctcaggagtgatggagaa
cctcagctcaggactcactccagaaggccagacaccactgctgtcggatatccgatcatc
cacgttgaaacctccaccctgggtgacatcagtaatgatgacaggaactctggggagtat
tacagtggagatgagtttaatgaggatggtgtcatgctggctacagacaggtcttacttt
caggacactttaattgatggtactccagctggacaacaggatgtgtgtgaatgtgtctgt
gatgatggtgagcatcttatatcccagcagtcccagaggtcatcaaaacgactcctgctg
tccacagctcaatcctctcacaagtctgctttccatttcgagtgtctgcgcaaacagaac
agtcaagatgagattcccctgcgtccaacaggcctaccgcagcatcaggtgaagatgccg
acgggacaagaatcgagtagaacacgactctctccgactcgctccatccgctcctgggtc
acgcctccagccacgcctccttcctacacccctctgattcagaccacgcccagcgctagc
agcactccgggattggttcacaggggcttctggaattcccagcaggcctctgattggtcg
acacgttcgccctccccctccttcctgaaggttcccccccgactgtgcggccatcacctg
cagcagcggagcagcgctcaaagcctggtggaagccgtgatgatatcgggtggattgggc
aaatatgcgaaggatccaaagtttgtgacggtgacaaaacacgagatcgcagatgcttgt
gaaatgacgattgatgagatggaaagtgctgctagcaatttactgaacgtgacgctaggc
cgtgggccagagacagacgaggcgggcctgtgtcagaataatctgcgtgactacagcgat
gaggagatggacacgagcaataaatgcgaggaggatctcgctgacgaaatgatctacgtc
tcagtattatag

KEGG   Sinocyclocheilus grahami: 107581799
Entry
107581799         CDS       T04918                                 

Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1D-like
  KO
K04851  voltage-dependent calcium channel L type alpha-1D
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04020  Calcium signaling pathway
sgh04218  Cellular senescence
sgh04260  Cardiac muscle contraction
sgh04261  Adrenergic signaling in cardiomyocytes
sgh04270  Vascular smooth muscle contraction
sgh04530  Tight junction
sgh04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107581799
   04020 Calcium signaling pathway
    107581799
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    107581799
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107581799
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    107581799
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107581799
   04261 Adrenergic signaling in cardiomyocytes
    107581799
   04270 Vascular smooth muscle contraction
    107581799
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:sgh04040]
    107581799
Ion channels [BR:sgh04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107581799
SSDB
Motif
Pfam: Ion_trans CAC1F_C Ca_chan_IQ GPHH PKD_channel FAM176 Rer1
Other DBs
NCBI-GeneID: 107581799
NCBI-ProteinID: XP_016122938
LinkDB
Position
Unknown
AA seq 1937 aa
MSANGSAPPAATPAVPPAASVPVSSVVPVGSLAQKKRQQYAKSKKQGSSANTRPQRALFC
LNLNNPIRRACISLVEWKPFDVFILIAIFANCMALAVYIPFPEDDSNSTNHDLETVEYAF
LIIFTIETFLKIIAYGLVMHQNAYVRNGWNMLDFVIVVIGLFSVVLEILTKDGEKESVGS
HPSAHGHGGKSGGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLF
VIIIYAIIGLELFIGKMHATCYFQGTDIIEDEPAPCAVNGHGRTCPINGTVCKEGWHGPN
GGITNFDNFMFAMLTVFQCITMEGWTDVLYWMNEAMGLELPWVYFVSLVIFGSFFVLNLV
LGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENEEEDEESKR
NRVTLASLMEKKKKGFSWFSQSSDTHASMPASETESMNTEIEKEDEKATCCGPTCQKISK
SKFSRRWRRWNRLCRRNCRLAVKSVPFYWLVIILVFLNTLTISSEHYNQPLWLTQVQDVA
NKVLLALFTCEMLVKMYSLGLQAYFVSLFNRFDCFVVCGGITETILVEFEIMSPLGISVF
RCVRLLRIFKVTRHWASLSNLVASLLNSMKSIASLLLLLFLFIIIFSLLGMQVFGGKFNF
DETQTKRSTFDNFPQALLTVFQILTGEDWNAVMYDGIMAYGGPSSSGMIVCIYFIILFIC
GNYILLNVFLAIAVDNLADAESLNTDSGDKKKGDENEENEEDAKAGEEDEKDNAEEDEDE
PDVPAGPRPQISELIKKEKITPIPEGSAFFIFSNTNPIRVACHKLINHHIFTNLILVFIM
LSSASLAAEDPIRNFSARNIILGYFDYAFTAIFTVEIVLKMTTYGAFLHKGAFCRNYFNL
LDLLVVGVSLVSFGIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGN
IMIVTTLLQFMFACIGVQLFKGKFYRCNDAIKSSPEECKGIYILYKEGDVNQPIIQKRHW
HNSDFNFDNVLMAMMALFTVSTFEGWPALLYKAIDSNRENLGPIYNYRVEISIFFIIYII
IIAFFMMNIFVGFVIVTFQEQGEKEYKNCELDKNQRQCVEYALKARPLRRYIPKNPYQYK
FWYVVNSTGFEYIMFVLILLNTICLAVQHYGQSELFNYVMDILNMGFTAVFTVEMVLKLI
AFKPRHYFTDAWNTFDALIVVGSVVDIAITEVNVSTTVFAFPSLEALQEKHVWCPTQIIS
TRSHHLDEFKRIWSEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVAMNM
PLNSDGTVMFNATLFALVRTALKIKTEGNLEQANEELRAVIKKIWKRTSMKLLDQVVPPA
GDDEVTVGKFYATFLIQDYFRKFKKRKEEGLVGVHPAQNNTAIALQAGLRTLHDIGPEIR
RAISCDLQDDELVDFIPEEDEEIYRRNGGLFGNHINHINGDPRRSSGHQTNATQRPLQVQ
PPPHYAHMEQPMGRLGRANAMAQQNHHRHHHHHHHHHHHHNSYNKSPKSTNINLNNANVS
SLPNGGHNRYYEHMPANGYPGSYYGEYDKPRSPHGQRRRYYETYIRSQGSDRRRPTIRRE
EEYEEDRYSGEYYSGEEFYEDDSMLSGDRCPNSDQEYETPRGYHHPDSYYEDDEQPLYHD
SCRSPKRRLLPPTPQGNRRPSFNFECLRRQSSQDDLPHQHTALPLHLMQHQVMAVAGLDS
SRAHRLSPTRSTRSWASPPPTPASQDRTPYYTPLIRVDRPLRDSAHSSHSSIRKSSWYTD
DPEYQRNYSPVHLQVPPEYRNQYHQKRGSATSLVEAVLISEGLGRYAKDPKFVAATKHEI
ADACEMTIDEMESAASHLLNGGITPGVNGVNVFPIMGPRDYEMQDVSASYSDEEPELEPK
PRYEEDLADEMICITTL
NT seq 5814 nt   +upstreamnt  +downstreamnt
atgagcgccaacggctctgctccgcctgctgcgactcctgccgtgccccctgcagcctcc
gtgcctgtatcgtcagtggtaccggtcggctcgctggcccagaagaagcggcagcagtat
gccaagagcaaaaaacagggcagttcggccaacacgcggcctcagagagctctcttctgc
ctcaacctcaacaaccccatccgccgggcctgtatcagcctcgtggaatggaagccattt
gatgtctttatattgatagcgattttcgccaactgcatggccttagctgtatacatcccc
tttcccgaggatgattccaactcaaccaaccacgacctggaaacagtcgaatatgccttc
cttatcattttcactatcgaaaccttcctgaagatcatagcgtacggcttggtgatgcat
cagaacgcgtatgtgcgaaacggatggaacatgctggatttcgtcattgtcgtcatagga
ttgtttagtgttgtcttggaaattctgaccaaagatggggagaaggaatctgttggaagc
cacccgtccgctcacggccatggtgggaaatcaggaggttttgatgtcaaagccctcaga
gcctttcgagtgctgcgaccgcttcgcctggtctcaggagtgcccagtttacaggtggtg
ctgaactccatcattaaagccatggttcccctcctccacatcgctctgctggttctgttt
gtcatcatcatctacgccatcatcggtttggagcttttcattggaaaaatgcacgctacc
tgttactttcaagggacagatataatagaggatgaacccgctccgtgtgccgttaacggt
catggccgcacatgccccattaacggcactgtgtgtaaggagggctggcatggccccaac
ggaggcatcacgaacttcgacaacttcatgtttgccatgcttactgtgttccagtgcatc
actatggagggctggacggatgtgctctactggatgaatgaagctatggggttggagctg
ccctgggtgtactttgtgagcttggtcatcttcggctctttcttcgtcttgaacctggtt
ctgggtgtgttgagcggggagttctctaaagagcgagagaaggcgaaggctcgtggagat
ttccagaagctacgggagaaacagcagctggaggaagatctgaaaggttatctggactgg
atcacgcaagccgaagacatcgaccctgagaatgaggaggaagatgaggaaagcaaacgc
aaccgggttacactggccagcctgatggagaagaagaagaaaggctttagctggttcagc
cagtcctctgacactcatgcgagtatgccggcaagtgagacagaatccatgaatacagaa
attgagaaagaagatgagaaggcaacatgttgtggcccaacatgtcaaaaaatttctaaa
tcaaaattcagtcggcgctggcgtcgctggaaccggttgtgtcggaggaattgtcgtttg
gctgtgaaatctgtgccgttctattggctggtgatcatcctggtgttcctcaacactttg
accatctcttcagaacattacaaccagcccttgtggctcacgcaagtccaggatgtggcc
aataaagtgctgctggccctgttcacgtgcgagatgttggtgaagatgtacagtctgggc
ctgcaggcttattttgtgtctttgtttaatcgctttgactgcttcgtggtgtgtggaggc
atcacagagaccatcctagtcgagtttgagatcatgtcacctctaggcatctcagtgttt
cgatgtgtgcgacttctcaggatctttaaagtcacacgtcactgggcgtctctcagtaac
ttggtggcatctctgctgaactccatgaagtccatcgcttctctactgctgctgctcttc
ctcttcatcatcatcttcagcctcctcggtatgcaggtgttcggcggcaagtttaacttc
gatgagacacaaacgaagaggagcacctttgacaacttccctcaggccttgctcactgtg
tttcagattcttactggtgaagactggaatgccgtcatgtacgatggaattatggcatat
ggcggcccatcatcgtcaggaatgattgtgtgcatctactttatcattctgttcatttgt
ggaaactacattcttctgaatgtgttcttggctattgctgtggacaaccttgccgacgca
gagtctctgaacacagacagcggcgataagaagaaaggtgatgaaaacgaggaaaatgaa
gaagatgccaaggctggagaggaggatgagaaggacaatgcagaggaggatgaagatgag
ccggacgttcctgcggggccccgcccacagatctcagagctcattaagaaggagaaaatc
acgccaatcccagagggcagtgcgttcttcatctttagcaacacaaacccaattcgtgtc
gcgtgccacaagctgataaaccaccacatcttcaccaatctcatcctcgttttcattatg
ttaagctccgcctccttggcagctgaggacccaatcagaaacttctctgcccggaatatt
atacttggttactttgactatgctttcacggctatctttactgtagagatcgtgttaaag
atgaccacgtatggtgcgtttctccacaagggggctttctgcaggaactactttaatctt
ctcgatctgctggtggttggcgtgtcgctggtgtccttcggaattcaatcatcagccatc
tcagtggtgaagattctgagggttctgagggtgctgcgtccactcagggccataaacaga
gctaaaggactgaagcatgtggtccagtgtgtgtttgtggccatcagaactattggaaac
atcatgattgtcaccacactgttacagttcatgtttgcctgcattggtgtacagctcttc
aaggggaagttttatcgttgtaatgatgcaatcaagtccagcccagaggagtgcaaggga
atatatatcctgtataaggaaggtgacgtgaaccagccaatcattcagaagcgccattgg
cacaacagcgatttcaactttgataacgtgctcatggccatgatggctctattcacagtg
tccacgtttgaaggctggccagcgttgttgtacaaggccatagactccaaccgggagaac
ttgggtccgatctacaactaccgtgtggagatttccatcttcttcatcatctacattatc
atcatcgccttctttatgatgaacatcttcgtgggtttcgtcatcgtgacctttcaggaa
cagggagagaaagagtacaagaactgtgagctggacaagaaccagcgtcagtgtgtggag
tatgcgttaaaagcacgtcctctcaggaggtacatcccaaagaacccgtatcagtataag
ttttggtatgtggtgaactccaccggcttcgagtacatcatgtttgtcctgatcttactc
aacaccatctgtctcgccgttcagcactacggtcagtccgagctgttcaattatgttatg
gacatcctgaatatgggcttcactgccgtctttactgtggagatggtactcaaactgatc
gccttcaaaccccggcattatttcactgatgcatggaacacgtttgacgccttaattgtt
gtcggtagcgtcgtagatattgctatcactgaagtcaacgtaagtacaaccgtattcgcc
tttccaagtttagaagccttgcaagaaaaacatgtctggtgcccaacacaaattatatcc
acaagaagtcatcatcttgatgaatttaagaggatttggtcagagtatgatccagaggcc
aaaggcagaataaaacatcttgatgtagtgacgttgttgcgccgtattcagcctcctctt
ggctttgggaagctctgtcctcatagagtcgcctgcaagaggctggtggctatgaacatg
cctctgaacagtgatggcactgtcatgtttaatgctacactttttgctcttgtgagaact
gcactgaagatcaaaacggaaggtaacctagagcaggcgaatgaagagctccgagccgtg
attaagaagatctggaagagaacaagcatgaaacttctggatcaagtggtgccccctgct
ggtgatgatgaggtaacggtggggaagttctatgccactttcctgatacaggactacttt
aggaaattcaagaaacgcaaagaggaaggcctggtgggcgttcacccagcacagaacaac
accgctatcgccctgcaggctggccttcgtacgctgcatgacattgggccagaaatccgc
cgtgcgatatcatgtgacctgcaggatgatgagctagtagactttataccagaggaggac
gaagaaatttataggcgaaatggaggactctttggcaaccacatcaaccacataaatgga
gacccccggaggagctccggccaccagacaaatgccacacagcgccccctgcaggtgcag
ccacctccacattatgcccacatggaacagcccatggggcgcctgggccgcgccaatgcc
atggcgcagcaaaaccatcatcgccaccaccaccaccatcatcaccatcatcatcatcac
aactcctacaacaagtcgcccaagtctaccaacatcaacctcaacaacgccaatgtgtcc
agcttacccaacggaggacacaatcgttactatgagcacatgcccgctaacggttacccg
ggatcgtactacggagaatacgacaagcccaggagccctcacggacaaagaaggcgctac
tatgagacgtatattaggtcgcagggcagcgacagaagacgacccactatacgccgcgaa
gaggagtatgaagaagatcgttactctggagagtactacagcggagaggagttttacgaa
gatgacagcatgctgtcgggtgacaggtgccccaacagtgaccaggaatacgagacgcca
cggggttaccatcatcctgacagttactatgaggatgacgagcagcccctttatcatgat
tcatgtaggtcaccaaagagaagactgcttcctccaacaccgcaaggtaatcggagacca
tcgtttaattttgagtgtctgcgcagacagagtagtcaagatgatcttcctcaccagcac
accgctcttccattacatctcatgcaacaccaggtgatggcggtagcaggcctagactcc
agcagggctcacaggctttcacctactcgatctaccagatcatgggcgtcacctcctccc
actcctgcaagtcaagaccgaacgccgtactacacgccgcttatccgcgtggaccgtcct
ctgagggacagcgcccacagcagccactcatccatcaggaagagctcgtggtatacagac
gaccctgagtaccagaggaactactcgcccgttcacctgcaggtgccacccgagtacaga
aaccagtaccaccagaagagaggcagcgctaccagcctggtcgaggcggtcttgatatca
gaaggactgggtcgctatgccaaggatccgaagttcgtggctgccacgaagcacgagatc
gcggatgcctgcgagatgaccattgacgaaatggagagcgccgccagccatctcctgaac
ggcggcattacgccaggagtcaatggcgtcaatgtctttcccataatgggccccagagac
tacgagatgcaggatgtctcggctagctacagcgacgaggaaccagaactcgaacccaaa
ccgcggtacgaggaggacctggcagacgaaatgatatgcattaccactttatag

KEGG   Sinocyclocheilus grahami: 107582429
Entry
107582429         CDS       T04918                                 

Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1D-like
  KO
K04851  voltage-dependent calcium channel L type alpha-1D
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04020  Calcium signaling pathway
sgh04218  Cellular senescence
sgh04260  Cardiac muscle contraction
sgh04261  Adrenergic signaling in cardiomyocytes
sgh04270  Vascular smooth muscle contraction
sgh04530  Tight junction
sgh04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107582429
   04020 Calcium signaling pathway
    107582429
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    107582429
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107582429
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    107582429
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107582429
   04261 Adrenergic signaling in cardiomyocytes
    107582429
   04270 Vascular smooth muscle contraction
    107582429
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:sgh04040]
    107582429
Ion channels [BR:sgh04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107582429
SSDB
Motif
Pfam: Ion_trans CAC1F_C Ca_chan_IQ GPHH PKD_channel FAM176 Trypan_PARP
Other DBs
NCBI-GeneID: 107582429
NCBI-ProteinID: XP_016123762
LinkDB
Position
Unknown
AA seq 1970 aa
MSANGPAPPAATPAAPPAASVPVSSVVPVGSLAQKKRQQYAKSKKQGSSANTRPQRALFC
LNLNNPIRRACISLVEWKPFDIFILIAIFANCMALAVYIPFPEDDSNSTNHDLETVEYAF
LIIFTIETFLKIVAYGLVMHQNAYVRNGWNMLDFVIVVIGLFSVVLEVLTKEGEKDTAGS
LPPVHGHGGKPGGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLF
VIIIYAIIGLELFIGKMHATCYFQGTEIIAEDEPAPCAVNGHGRTCPINGTVCKEGWHGP
NGGITNFDNFMFAMLTVFQCITMEGWTDVLYWMNDAMGLELPWVYFVSLVIFGSFFVLNL
VLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENEEEDEESK
RNRVTLASLMEKKKKGFNWFSQSSDTHASMPASETESMNTENEKGEEEKATCCGPTCQKI
SKSKFSRRWRRWNRMCRRNCRLAVKSVPFYWLVIILVFLNTLTISSEHYNQPLWLTQVQD
VANKVLLALFTCEMLVKMYSLGLQAYFVSLFNRFDCFVVCGGITETILVEIEIMSPLGIS
VFRCVRLLRIFKVTRHWASLSNLVASLLNSMKSIASLLLLLFLFIIIFSLLGMQVFGGKF
NFDETQTKRSTFDNFPQALLTVFQILTGEDWNAVMYDGIMAYGGPSSSGMIVCIYFIILF
ICGNYILLNVFLAIAVDNLADAESLNTDSNDKKKGDENEDDAKAGEEDEKDNAEEDEDEP
DVPAGPRPQISELVKKEKITPIPEGSAFFIFSSTNPIRVACHKLINHHIFTNLILVFIML
SSASLAAEDPIRNFSARNIVLGYADYVFTSMFTFEIVLKMTTYGAFLHKGAFCRNYFNLL
DLLVVGVSLVSFGIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNI
MIVTTLLQFMFACIGVQLFKGKFYRCTDDTKSSPEECKGIYILYKDGDANLPIIQKRHWH
NSDFNFDNVLMAMMALFTVSTFEGWPALLYKAIDSNRENMGPIYNYRVEISIFFIIYIII
IAFFMMNIFVGFVIVTFQEQGEKEYKNCELDKNQPTEAPQVDETGNTEDSARISITFFRL
FRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIAMLFFIYAVIGMQVFGKIAMVDH
TQINRNNNFQTFPQAVLLLFRCATGEAWQDIMLACMPGKLCDPESDYNPGEEMTCGSNFA
IIYFITFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWSEYDPEAKGRI
KHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVAMNMPLNSDGTVMFNATLFALVRTALKI
KTEGNLEQSNEELRAVIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQDYFRKFK
KRKEEGLVGVHPAQNNTAVALQAGLRTLHDIGPEIRRAISCDLQDDELVDFMPEEDEEIY
RRNGGLFGNHINHINGESRRSSGHQTNATQRPLQVQPPPHYAHMEQTVGRLGRANAMAQQ
NHHRHHHHHHHHHHHHNSYNKSPKSTNINLNNANVSSLPNGGHNRYYEHMPANGYPGSYY
GEYDKPRSPHGQRRRYYETYIRSQGSDRRRPTIRREEEYEEDRYTGEYYSGEEFYEDDSM
LSGDRYPNSDQEYETPRGYHHPDSCYEDDELPLYHDSHRSPKRRLLPPTPQGNRRPSFNF
ECLRRQSSQDDLPHQRTALPLHLMQHQVMAVAGLDSSRAHRLSPTQSTRSPPPTPASKDR
TPYYTPLIRVDRPLRDSVHSSHSSIRKSLWYTDDPEYQRNYSPVHLQVPPEYRNQYHQKR
GSATSLVEAVLISEGLGRYAKDPKFVAATKHEIADACEMTIDEMESAASHLLNGGITPSA
NGVTVFPIMGHRDYELQDVSASYSDEEPEPEPRPQYEEDLADEMICITTL
NT seq 5913 nt   +upstreamnt  +downstreamnt
atgagcgccaacggccctgctccgcctgctgcgactcctgccgcaccccccgcagcctcc
gtgcctgtatcgtcagtggtaccggtcggctcgctggcccagaagaagcggcagcagtat
gccaagagcaaaaaacagggcagttcggccaacacgcggccgcagagagctctcttctgc
ctcaacctcaacaaccccatccgccgggcctgtatcagcctcgtggaatggaagccattt
gatatctttatattgatagcgatttttgccaactgtatggccttagctgtatacatcccc
tttcccgaggatgattccaactcaaccaaccacgacctggaaacagttgaatatgccttc
cttatcattttcactatcgaaaccttcctgaagatcgtagcatatggcttggtgatgcat
cagaacgcatatgtccgaaacggatggaacatgctggatttcgtcattgtcgtcatagga
ttgtttagtgttgtcttggaagttttgaccaaagaaggggagaaggatactgctggaagc
ctcccgcctgttcacggccatggagggaaaccaggaggtttcgatgtcaaagccctcaga
gcctttcgagtgctgcgacctcttcgcctggtctcaggagtgcccagtttacaggtggtg
ctgaactccatcattaaagccatggttcccctcctccacatcgccctgctggttctgttc
gttatcatcatctacgccatcatcggtttggagcttttcattggaaaaatgcacgctacc
tgttactttcaagggacagaaataatagcagaggatgaacccgcaccatgtgctgttaac
ggtcatggccgcacatgccccattaatggcaccgtgtgtaaggagggctggcacggcccc
aacggaggcatcacgaacttcgacaacttcatgtttgccatgctcactgtgtttcagtgc
attaccatggagggctggacggatgtgctctactggatgaatgatgctatggggttggag
ctgccctgggtgtactttgtgagcttggtcatcttcggctctttcttcgtcttgaacctg
gttctgggtgtgttgagcggagagttctctaaagagcgagagaaggcgaaggctcgtgga
gatttccaaaagctacgggagaaacagcaactggaagaagatctgaaaggttatctggac
tggatcacgcaagccgaagacatcgaccctgagaatgaggaggaagatgaggaaagcaaa
cgcaaccgggttacattggccagcctgatggagaagaagaagaaagggtttaactggttc
agccagtcctctgacactcatgcaagcatgccggcgagtgagacagaatccatgaataca
gaaaatgagaaaggagaagaggagaaggcaacatgttgcggcccgacatgtcaaaaaatt
tcaaaatcaaagttcagtcggcgctggcgtcgctggaaccggatgtgtcgaaggaattgt
cgtttggctgtgaaatctgtgccattctattggctggtgatcatcttggttttcctcaac
actttgactatctcttcagaacattacaaccagcccctgtggctcacgcaagtccaggat
gtggccaataaagtgctgctggccctgttcacgtgtgagatgttggtgaagatgtacagt
ctgggtctgcaggcttattttgtgtctctgtttaatcgctttgactgctttgtggtgtgc
ggaggcatcacagagacgatcctagtcgagattgagattatgtcacctctcggcatctca
gtgtttcgatgtgtgcgacttctcaggatctttaaagtcacacgtcattgggcatctctc
agtaacttggtggcatctctgctgaactccatgaagtccattgcttctctactgctgctg
ctcttcctcttcatcatcatcttcagcctccttggtatgcaggtgtttggtggcaagttt
aactttgacgagacacaaacgaagaggagcacctttgacaacttccctcaggccttgctc
actgtgtttcagattctgaccggtgaagactggaatgccgtcatgtacgatggaattatg
gcgtacggcggcccatcatcgtcaggaatgatcgtgtgcatctacttcatcattctcttc
atatgtggaaattacattcttctgaatgtgttcttggctatcgctgtggacaaccttgcc
gacgcagagtctctgaacacagacagcaacgataagaagaaaggtgatgaaaacgaagat
gacgccaaggctggagaggaggatgagaaagacaatgcagaggaggatgaagatgagccg
gacgttcctgcagggccccgcccacagatctcagagcttgttaagaaggagaaaatcact
ccaatcccagagggcagtgcgttcttcatctttagcagcacaaacccaattcgtgtcgcg
tgccacaagctgataaaccaccacatcttcaccaacctcatccttgtcttcattatgcta
agctccgcctccttggcagctgaggacccaatcagaaacttctctgcccggaatattgtc
ctaggctatgcagattatgtcttcactagtatgtttacatttgagatcgtgttgaagatg
accacgtatggagcgtttctccacaagggggctttctgcaggaactactttaatcttctt
gatctgctggtggtcggcgtgtcgctggtgtccttcggaattcaatcgtcggccatctca
gtggtgaagatactgagggttctgagggtgctgcgtccactcagggccataaacagagct
aaaggactgaagcatgtggtccagtgtgtgtttgtggctatcaggactatcggaaacatc
atgattgtcaccacactgctacagttcatgtttgcctgcattggtgtacagctcttcaag
gggaagttttaccgctgtactgatgacaccaagtccagcccagaagagtgcaagggaata
tatatcctgtataaggatggagacgcgaacctgccaatcattcagaagcgccactggcac
aacagcgatttcaactttgataacgtgctcatggccatgatggctctattcacagtgtcc
acgtttgaaggctggccagcgttgttgtacaaggccatagactccaaccgggagaacatg
ggtccgatctacaactaccgtgtggagatttccatcttcttcatcatttacatcatcatc
atcgccttcttcatgatgaacatcttcgtgggtttcgtcattgtgacctttcaggaacag
ggagagaaagagtacaaaaactgtgagctggacaagaaccagcccacagaggcacctcag
gtggatgagacggggaacactgaagacagcgctcgcatttcaatcaccttcttccgtctt
ttccgagtgatgcgattggtcaagctactgagcaggggggagggcattcgaacccttctc
tggaccttcatcaagtccttccaggccctgccgtatgtcgctttgctgatagccatgctc
ttcttcatctatgctgtcattggcatgcaggtgtttgggaaaattgccatggtggaccac
acacaaatcaacaggaacaacaactttcagacgttccctcaggctgtgcttctgctcttc
agatgtgcaacaggtgaagcctggcaggatatcatgttggcatgtatgccagggaagctg
tgtgacccggagtcagactataatccaggagaagagatgacctgcgggagcaactttgcc
atcatctacttcatcaccttctacatgctctgcgccttcctgatcattaacctgtttgtg
gctgtcatcatggacaactttgactatctgacccgtgattggtcgattctggggccacat
catcttgatgaatttaagaggatttggtcagagtatgatccagaggccaaaggcagaata
aaacatcttgatgtagtgacgttgttgcgccgtattcagcctccacttggctttgggaaa
ctctgtcctcatagagtcgcctgcaagaggctggtggctatgaacatgcctctgaacagt
gacggcactgtcatgtttaatgcaacactttttgctcttgtgagaactgctctgaagatc
aaaacggaaggtaacctagagcagtccaacgaagagctcagagctgtgattaagaagatc
tggaagagaacaagcatgaaacttctggatcaagtagtgccccctgctggtgatgatgag
gtaacggtggggaagttctatgccactttcctgatacaggactactttaggaaattcaag
aaacgcaaagaggaaggcctggtgggcgttcacccagcacagaacaacaccgctgtcgcc
ctgcaggctggccttcgtacgctgcatgacattgggccagaaatccgccgtgcgatatca
tgtgacctgcaggatgatgagctagtagactttatgccagaggaggacgaagaaatttat
aggcgaaatggaggactctttggcaaccatatcaaccatataaatggtgaatcccggaga
agctccggccaccagacaaatgccacacagcgccccctgcaggtgcagccgcccccacat
tacgcccacatggaacagaccgtggggcgcctgggtcgcgccaatgccatggcgcagcaa
aaccatcatcgccaccaccaccaccatcatcaccatcatcatcatcacaactcctacaac
aagtcacccaagtctaccaacatcaacctcaacaacgccaatgtgtccagcttacccaac
ggaggacacaatcgttactatgagcacatgcccgctaacggttacccgggatcgtactac
ggagaatacgacaagcccaggagccctcacggacaaagaaggcgctactatgagacgtat
attaggtcgcagggcagtgacagaagacgacccactatacgccgcgaagaggagtatgaa
gaagatcgttacactggagagtactacagtggagaggagttttacgaagacgacagcatg
ctgtcgggtgacaggtaccccaacagtgaccaggaatatgagacaccacggggttaccat
catcctgacagctgctatgaggatgacgagctgcccctttatcacgattcacataggtca
ccaaagagaagactacttcctccaacaccgcaaggtaatcggagaccgtcgtttaatttt
gagtgtctgcgcagacagagcagtcaagatgatcttcctcaccagcgtactgctcttcca
ttacatctcatgcaacaccaggtgatggctgtagcgggtctcgactccagcagggctcac
aggctttcacctacacaatctaccagatcacctcctcccactcctgcaagtaaagaccga
acgccgtactacacaccgcttatccgcgtggaccgtcctctgagggacagtgtccacagc
agtcactcatccatcaggaagagcttgtggtatacagacgaccccgagtaccagaggaac
tactcacccgttcacctgcaggtcccgcccgagtatagaaaccagtaccaccagaagcga
ggcagcgctactagcctggtagaggcggtcttgatatcagaaggactgggtcgatatgcc
aaggatccaaagttcgtggccgccacgaagcacgagatcgcagacgcatgcgagatgacc
atcgacgaaatggagagcgccgccagccatctcctgaacggcggcattacgccgagtgcc
aacggcgtcactgtctttcccataatgggccacagagactacgagctgcaagatgtctcc
gctagctacagtgatgaggaaccagaacccgaacccagaccgcagtatgaggaggacctg
gcagacgaaatgatatgcattaccactttatag

KEGG   Sinocyclocheilus grahami: 107594982
Entry
107594982         CDS       T04918                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: voltage-dependent L-type calcium channel subunit alpha-1D-like
  KO
K04851  voltage-dependent calcium channel L type alpha-1D
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04020  Calcium signaling pathway
sgh04218  Cellular senescence
sgh04260  Cardiac muscle contraction
sgh04261  Adrenergic signaling in cardiomyocytes
sgh04270  Vascular smooth muscle contraction
sgh04530  Tight junction
sgh04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107594982
   04020 Calcium signaling pathway
    107594982
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    107594982
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107594982
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    107594982
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107594982
   04261 Adrenergic signaling in cardiomyocytes
    107594982
   04270 Vascular smooth muscle contraction
    107594982
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:sgh04040]
    107594982
Ion channels [BR:sgh04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107594982
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel FAM176 Rer1
Other DBs
NCBI-GeneID: 107594982
NCBI-ProteinID: XP_016140714
LinkDB
Position
Unknown
AA seq 1895 aa
MDEPEEPTEGANYASGTRAPVSSDAPPVWLEAPSITSHHSPAQSAALSWQAAINAARQSQ
GTPKTMNFSAAASTAPAGSLAQRKRQQYAKSKKQGSTTNSRPPRALFCLTLNNPVRRACI
NLVEWKPFDIFILLSIFANCVALAVYIPFPEDDSNSTNHDLETVEYAFLIIFTIETFLKI
IAYGLVMHQNSYVRNGWNMLDFVIVIVGLFSVVLELVTKDRDVSGQSGGKPGGFDVKALR
AFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHAT
CYLNGTRALAEEDPAPCSLTGHGRHCPLNGTMCRDGWHGPNNGITNFDNFLFAMLTVFQC
ITMEGWTDVLYWMNDAMGSELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARG
DFQKLREKQQLEEDLKGYLDWITQAEDIDPDNDEEGDQEAKRSRVTLGDLTHRKNTGNSG
WFSQSTETHGKFSSVCVFECDRHFICAATYSVKTTLHSIYICVANKVLLALFTCEMLIKM
YSLGLQAYFVSLFNRFDCFVVCGGIVETILVELEIMSPLGISVFRCVRLLRIFKVTRHWA
SLSNLVASLLNSMKSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDETVTKRSTFXQLSSS
PADCLSGILTGEDWNTVMYDGIMAYGGPSSSGMLVCIYFIILFICGNYILLNVFLAIAVD
NLADAESLNSAQKEEEKRNKRKKSRSMSIHKRDGDDGDVKASGDQEGDQDQTEDMIDSSE
EDEKDEPEVPSGPRPLRLSELSLREKMPPIPEGSAFFILSNTNPIRVACHRLINHQIFTN
LILIFIMLSSVSLAAEDPIRNFSARNIVLGYFDYAFTAIFTVEILLKMTAFGAFLHKGAF
CRNYFNLLDLLVVGVSLVSFGIQSSAISVVKILRILRVLRPLRAINRAKGLKHVVQCVFV
AIRTIGNIMIVTTLLQFMFACIGVQLFKGKFYRCSDDAKTSPEDCRGTYIVYSIGETALP
QMRERIWYNSDFNFDNVLMAMMALFTVSTFEGLPALLYKAIDSNKENMGPIYNYRVEISI
FFIIYIIIIAFFMMNIFVGFVIVTFQEQGEKEYKNCELDKNQRQCVEYALKARPLRRYIP
KNPYQYKFWYVVNSTGFEYVMFVLIVLNTLCLAVQHQGQSRLFNYGMDILNMVFTGVFAV
EMILKLVAFKPKHYFADAWNTFDALIVVGSIVDIAITEINNTEGSARISITFFRLFRVMR
LVKLLSRGEGIRTLLWTFIKSFQALPYVALLIAMLFFIYAVIGMQVFGKIAMVDGTSINR
NNNFQTFPQAVLLLFRCATGEAWQLIMLACLPGKQCDSESDYNPGEEKSCGSNFAILYFI
SFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWSEYDPEAKGRIKHLDV
VTLLRRIQPPLGFGKLCPHRVACKRLVAMNMPLNSDGTVMFNATLFALVRTALKIKTEGN
LDQANEELRAVIKKIWKRTSMKLLDQVVPPAGGQTHTHTHTLDSMFYGDEGLVDVNLHEE
EEIYENLRSDGEPQLRTHSRRPSTSAVEYPIIHVENSTLGDISDDDRNSGEYYSGDEFNE
DDVMLATDRSYFQDTLSDGAPAGQQDTCECVCDDGEQLISQQPQRSSKRLLMSTAQSSHK
PAFHFECLRKQNSQDEIPLHPTGLPQHQVKTPTGQESSRTRLSPTRSIRSWVTPPATPPP
YTPLIQTTPSASSTPGLVHRGFWNSQQASDWSTRSPSPSLLKVPPRLSGHHLQQRSSAQS
LVEAVMISGGLGKYAKDPKFVTATKHEIADACDMTIDEMESAASNLLNVTLGHGPEADEA
GLCQNNLRDYSDEETDTSNKREEDLADEMIYVSVL
NT seq 5688 nt   +upstreamnt  +downstreamnt
atggacgagccagaggaaccgactgaaggggcaaactatgccagtggcaccagagccccc
gtctctagtgatgctcctcctgtctggttggaagcaccgtcgatcaccagccatcattcg
ccggcccagtccgccgcgctctcctggcaggctgcgattaatgccgccagacagtctcag
ggcacccccaaaaccatgaacttctctgctgctgcaagcactgctccagccggctcgctc
gcccagaggaaacgtcagcaatatgccaaaagcaagaaacagggaagcaccactaatagc
agacctccaagagcacttttctgcctgactctcaataatcctgtgcgcagagcatgcatt
aacctagtggagtggaaaccttttgatatctttatactgctgtcaatatttgccaactgt
gtggccttagctgtttacatcccctttcctgaagacgattccaactcaactaatcatgat
ttggaaacggtagaatatgccttcctgataattttcacgattgaaaccttcctcaagatc
atagcttatggacttgtgatgcaccaaaactcctatgtgagaaacggctggaatatgttg
gattttgtcatcgtcatagtaggtctcttcagtgtcgtgctggagctggtaaccaaagat
cgagatgtcagcgggcagtcaggtggcaagccgggcgggttcgatgtcaaggctttacga
gcatttagagttctgcggcccctccgcctggtgtcaggagtgccaagcttacaggtagtg
ctgaactccatcattaaagccatggttcctctgctgcacattgctctgcttgtactcttc
gtcatcatcatctatgccatcatcgggctggagctgttcatcgggaagatgcatgcaacc
tgctatctgaacggcacgcgtgcattagcagaggaggacccagctccctgttctcttact
ggtcatgggagacactgccctctcaatggcactatgtgtagggatggttggcatggaccc
aacaatggcatcacaaactttgacaacttcctgtttgccatgctgactgtcttccagtgt
atcaccatggagggctggactgacgtgctgtactggatgaatgatgctatgggctctgag
ttgccttgggtctattttgtcagtctggtcattttcggctccttctttgtcctcaatcta
gtattgggcgttctaagtggagagttctctaaggagcgcgagaaggccaaggctcgtgga
gatttccagaaactgcgtgagaagcagcagcttgaggaggatctgaagggatatctagat
tggatcacacaagctgaggacatcgaccctgataatgatgaggagggagatcaagaggcc
aaacgcagccgggtgacgctgggcgatctcacccacaggaagaacacgggaaactcgggc
tggttcagtcagtccactgagactcatggtaaatttagttcagtttgtgtgtttgagtgt
gacagacacttcatatgtgcagcaacatattccgttaaaacaacattgcattcaatatat
atttgtgtggctaataaggtgttgttagccctgttcacatgcgagatgctgataaaaatg
tacagtctggggctgcaggcatactttgtgtcgcttttcaaccgcttcgactgcttcgta
gtttgcggaggcattgtggagacgatcctcgtggagcttgagatcatgtctcctctcggc
atctcagtatttcgctgcgtccggctcctcagaatctttaaagtcacacgtcactgggcg
tctctgagtaacctggtggcatctcttttgaactccatgaagtccattgcgtccctactg
ctgttgctcttcctcttcatcatcatcttcagtttgcttggcatgcagctcttcggaggg
aagtttaactttgacgagactgttaccaaacgaagcacttttngacaactttcctcaagc
cctgctgactgtctttcaggtatcctgacgggtgaggattggaatacagtgatgtatgat
gggatcatggcgtatgggggcccctcctcctcaggcatgctcgtgtgcatctacttcatc
atcctcttcatctgtggaaactacatcttactgaacgtcttcttggccattgctgtggat
aacctggcagatgctgaaagtctgaactcagcccagaaagaggaagagaagaggaacaag
aggaagaaaagcaggagtatgagcatacacaagagagatggtgacgatggagacgtcaag
gcatctggtgatcaggagggtgatcaggatcagacagaggacatgattgactcctcagag
gaggatgagaaagatgagcccgaggtaccatcaggcccgcggccgctgaggctgtcagag
ctgagcctcagagaaaagatgccccccatcccagagggcagcgccttcttcatccttagc
aacaccaacccgatccgtgtggcatgccatcggctcatcaatcatcagatcttcaccaat
ctcatcctcatcttcatcatgctgagctccgtctcgctggcagccgaggaccccatccgt
aacttctctgcccgaaacattgttcttggttattttgactatgccttcactgctatattt
acagtggagatcttgttgaagatgactgcgtttggtgctttccttcacaaaggagctttc
tgcagaaattactttaatttgctggatctgctggtggttggagtctccctcgtttccttc
ggcatacaatcgtcggccatttcagtggtgaagatcttaaggattctgcgtgtgcttcga
cctctgagagccatcaacagagccaaaggactcaaacatgtggttcagtgtgtgtttgtg
gccattaggacgattgggaacatcatgattgtcaccacacttcttcagttcatgtttgcc
tgtattggtgtacagctgtttaaggggaagttctaccgctgttctgatgatgcaaagaca
agtccagaggactgcagagggacgtatatcgtgtacagtattggtgagacggcactgcca
caaatgcgtgagaggatctggtacaacagtgactttaactttgataatgtgctgatggct
atgatggccctcttcaccgtctcaacgtttgagggcttgccagccctgctgtacaaggcc
atcgactcaaacaaggaaaacatgggtcccatctacaactaccgcgtggagatctccatc
ttcttcatcatctacatcatcatcattgccttcttcatgatgaacatttttgtgggtttt
gtcattgtcacgtttcaggagcagggcgagaaagagtacaagaactgtgagctggacaag
aaccagcgccagtgtgtggagtacgctctgaaagcccgtccgctgaggagatacatccct
aaaaacccgtaccagtataagttctggtatgtggtgaactccacgggctttgagtatgtc
atgtttgtgctcatcgtcctcaacacactgtgtctggccgttcagcatcaaggccagtca
cgtcttttcaattatgggatggacattttgaacatggtgttcacgggtgtctttgcagtc
gaaatgattctcaaactggttgccttcaaaccaaagcactattttgccgatgcatggaac
acgtttgatgccttaattgttgttggtagcatcgttgacattgcgatcacggagatcaat
aacacggaaggcagtgcaagaatttccatcacattctttcgtctgtttcgtgtcatgcgc
ttagtgaagttgctgagcagaggagagggcattcgcacgctcctgtggactttcatcaaa
tcatttcaggctcttccgtatgtggctctgcttattgccatgttgttcttcatctatgct
gtcattggaatgcaggtgtttgggaagatcgccatggtggatggaaccagtattaatcgt
aacaataatttccagacctttccacaagctgtgctcctgctgttcagatgtgcaacgggt
gaggcatggcagctaatcatgttggcgtgtttgcctggcaaacagtgtgactctgagtcc
gactataaccctggagaggagaaaagctgtggcagcaacttcgctatcctctacttcatc
agcttctacatgctctgtgcttttttgatcattaatctgtttgtcgctgtcatcatggac
aactttgactacctgacgcgtgattggtcaattcttggaccacatcatttagatgaattt
aagaggatctggtcggaatatgatcctgaggccaagggccgtataaaacacttagatgtg
gtgacattactgcgcaggattcaaccgccgctgggctttggcaagctgtgtccacataga
gtggcttgcaagaggttggttgccatgaacatgccactaaatagtgacggtacagtcatg
ttcaatgccaccctgttcgctctggtcagaactgctctgaaaatcaagactgaagggaat
ctggatcaagccaatgaggagttacgagccgtcatcaagaagatctggaagagaactagc
atgaaactcctggaccaagtagtgccacctgctggaggtcaaacacacacacacacacac
acactggattccatgttttatggggatgaaggtctagtagacgtcaacctccacgaggag
gaagagatatacgaaaacctcaggagtgatggagaacctcagctcaggactcactccaga
aggccgagcaccagtgctgtcgaatatcccatcatccatgtggaaaactccacccttggt
gacatcagtgatgatgacaggaactctggggagtattatagcggagacgagtttaatgag
gatgatgtcatgctggctacagacaggtcatactttcaggacactttgagtgatggtgct
ccagctggacagcaggatacgtgtgaatgcgtctgtgatgatggtgagcagctcatatcc
cagcagccccagaggtcctcaaaacgactcctgatgtccacagctcaatcctctcacaaa
cccgctttccattttgagtgtctgcgcaaacagaacagccaagatgagattcccctgcat
ccaacaggcctaccgcagcatcaggtgaagacgccgactggacaagaatcgagtagaaca
cgactctctccgactcgctccatccgctcctgggtcacgcctccggccacgcctccaccc
tacacccctctgattcagaccacgcccagcgctagcagcactccgggattggttcacagg
ggcttctggaattcccagcaggcctctgattggtcgacacgttctccctcaccctcgctc
ctgaaggttcccccccgactaagcggacatcacctgcagcagcggagcagcgctcaaagc
ctggtggaagccgtgatgatatctggtggattgggcaaatatgccaaggatccaaagttt
gtgacggcgacaaaacacgagattgcagatgcttgcgacatgacaattgatgagatggaa
agtgctgctagcaatttactgaacgtgacgctaggccacgggccggaggcagacgaggcg
ggcctgtgtcagaacaatctgcgtgactacagcgatgaggagacggacacgagcaataaa
cgcgaggaggatctcgcagacgaaatgatctacgtctcagtattatag

DBGET integrated database retrieval system