KEGG   Sinocyclocheilus grahami: 107549588
Entry
107549588         CDS       T04918                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B-like
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04012  ErbB signaling pathway
sgh04068  FoxO signaling pathway
sgh04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107549588
   04068 FoxO signaling pathway
    107549588
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107549588
SSDB
Motif
Pfam: CDI SPDY
Other DBs
NCBI-GeneID: 107549588
NCBI-ProteinID: XP_016086217
UniProt: A0A672NG52
LinkDB
Position
Unknown
AA seq 179 aa
MSNVRLSSGSPTLERMEARPSDQPKPSACRNLFGPVDHEELKKDFQRQLKAMEDASSDAW
SFDFSTHTPRTDGRYRWDALDVRSVPGFYSRSERGKGSDLHTCSSGNNNDNKVDVNGNHD
CRVTEQSAETPEKDREQRKRSSCLDSSCQSKRSHICVDEVTRTPRKPQKPRKHPSPTPT
NT seq 540 nt   +upstreamnt  +downstreamnt
atgtccaacgtgcgcttgtctagcggcagcccgacgctggagcggatggaggcgcgaccg
tcagaccagcccaagccgtcggcgtgtcggaacctgttcggtccggtggatcacgaagag
ctaaagaaagacttccagcggcagctgaaggcgatggaggacgcgtcgtctgacgcgtgg
agcttcgacttctccacgcacacgccgcgcaccgacggcaggtaccggtgggacgcgctg
gacgtgcgctcggtgcccggtttctacagcaggtctgagcggggcaagggctccgatctc
cacacgtgctcctctgggaataataacgacaataaagtggatgttaacggcaatcacgac
tgtcgggtaacggagcagagcgcggagacgcccgaaaaagaccgagagcagcggaaaaga
agctcctgtctcgactcgtcgtgtcaaagcaaacgctcgcacatctgcgtggatgaagtg
acccggacgcccagaaagccccaaaaacccagaaaacaccccagcccgactcccacataa

DBGET integrated database retrieval system