KEGG   Sinocyclocheilus grahami: 107549952Help
Entry
107549952         CDS       T04918                                 

Definition
(RefSeq) procollagen galactosyltransferase 2-like
  KO
K11703  collagen beta-1,O-galactosyltransferase [EC:2.4.1.50]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh00310  Lysine degradation
sgh00514  Other types of O-glycan biosynthesis
sgh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107549952
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    107549952
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:sgh01003]
    107549952
Enzymes [BR:sgh01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.50  procollagen galactosyltransferase
     107549952
Glycosyltransferases [BR:sgh01003]
 O-Glycan biosynthesis
  O-linked Gal type
   107549952
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_25 Glyco_tranf_2_4 Anp1
Motif
Other DBs
NCBI-GeneID: 107549952
NCBI-ProteinID: XP_016086623
LinkDB All DBs
Position
Unknown
AA seq 592 aa AA seqDB search
MVKGVKISLSFTHTPRSGCDSGVHQAEMPAEGFVMVAVICALMAQICRGELVAHVQDLNP
VPESSLLKPKVMIAILARNSAHSLPYYMGCIDRLDYPKDRIAIWAATDHNVDNTTAMLRE
WLRNRQSRYHYVEWRPMEEPRSYMDEWGPKHWAPSRFNHVMKLRQAALKAARERWADYIL
FVDSDNLLTNPRVLDLMMAENFTLVAPMLDSRSLYSNFWCGITPQGYYKRTPDYQPIREW
KRLGCFSVPMVHSTFLLDLRRSATLDMAFHPPHPDYSWAFDDIMVFAFSARQAGVQMYVC
NREHYGFLPVPLKAQQSVEEEEESFTHTITEAMIDHNIKPSEFLFTPPKPQDKMGFDEIF
LINLKRRLDRRERMLNTMAALGLEATLADAVDGKALNTSHLQALGIEMMPVYKDPYSGRV
LTRGEIGCFLSHHFTWKQVVERGLQHVLVLEDDVRFEPRFKRRLQTIMEDVGKAQLNWDL
IYVGRKRMQVAQPEVSVEGVDNLVEADYSYWTLGYALSQQGAKKLLAAQPFGKMLPVDEF
LPVMFNKHPNAAYMSHFDPRDLRAFSVEPLSLDVFRKPENHSSKKTSMSSNE
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagggtgtgaaaatcagcctctcgttcactcacacaccccgttcaggctgtgac
agcggtgtccatcaggcagagatgccggctgagggattcgtgatggtggctgtgatttgc
gctctgatggcgcaaatctgccgtggggagcttgtggctcacgtgcaggacctgaatccc
gtgcctgaatcctcgctgcttaagcccaaagtcatgatcgcgattctggctcggaactcg
gcgcacagcctgccgtactacatgggctgcatcgaccgcctggactacccgaaggaccgg
attgcgatatgggctgcaacggaccataatgtggacaacaccacagccatgctgagagaa
tggctgaggaacaggcagagcagataccattacgtggagtggaggcccatggaggagcca
cggtcatacatggatgagtgggggccgaaacactgggctccatctcgtttcaatcatgta
atgaagctcaggcaggcggcactgaaggctgcacgagagcgctgggctgattatatactg
tttgttgacagtgataacctcctgaccaacccacgggtgctggatctcatgatggcagag
aatttcacactggtggcgcccatgttggattcccgatccctctactcaaacttctggtgt
ggcatcacacctcagggttattacaagcgcaccccagactaccagcctatccgtgagtgg
aagcgtttgggctgtttctctgttcccatggtgcactccacattcctgttggatctgaga
cgtagtgccactctcgacatggctttccacccacctcaccctgactacagctgggcgttt
gatgacatcatggtctttgcattctccgcgcgacaagctggtgttcagatgtatgtgtgt
aacagagaacattacggctttctgcctgtacctctgaaggcccagcagagtgtagaagaa
gaggaggagagtttcacacacaccatcactgaggctatgattgatcataacataaaaccc
tctgagtttctcttcactccacccaaaccccaggacaagatgggctttgacgagatcttt
ctgattaatctgaagcggaggttggaccggagggaacggatgttgaacacaatggcggcg
ctgggtcttgaggctacactggctgatgctgtggatgggaaggctctgaatacatctcac
cttcaagctctaggtatagaaatgatgcctgtatataaagatccatattctggtagggtg
ctgacgcgtggagagattggctgtttcctcagccaccacttcacctggaaacaggtggtg
gagaggggtctgcagcatgtgctggtgttggaggatgacgtgaggtttgagcctcgattt
aaaaggaggttgcagaccatcatggaggacgttggaaaagctcagctgaactgggacctc
atatatgtgggccgtaaacggatgcaagtagctcagccagaggtgtctgtagagggtgtt
gataatctggtggaggctgattactcatattggactctaggttatgccctttcacagcag
ggggccaagaaactcctcgctgctcagccgttcggcaagatgctccctgtggatgagttc
ctgccagtcatgttcaacaaacacccaaatgcggcatacatgtctcactttgatcccaga
gatttgcgtgctttctctgttgagccactctcactagatgtgtttcgaaaacctgaaaac
cattcgagcaaaaagaccagcatgtcctccaacgagtaa

DBGET integrated database retrieval system