KEGG   Sinocyclocheilus grahami: 107549953Help
Entry
107549953         CDS       T04918                                 

Definition
(RefSeq) histone-lysine N-methyltransferase SUV39H1-A isoform X1
  KO
K11419  [histone H3]-lysine9 N-trimethyltransferase SUV39H [EC:2.1.1.355]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh00310  Lysine degradation
sgh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107549953
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sgh03036]
    107549953
Enzymes [BR:sgh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.355  [histone H3]-lysine9 N-trimethyltransferase
     107549953
Chromosome and associated proteins [BR:sgh03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107549953
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    107549953
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET Chromo Herpes_IE68 EGF_alliinase
Motif
Other DBs
NCBI-GeneID: 107549953
NCBI-ProteinID: XP_016086622
LinkDB All DBs
Position
Unknown
AA seq 411 aa AA seqDB search
MAQDLKDCRVSCKLSWEDLQALCRRERLVCKQLSVTKNNFNDYEVEYLCNYKKHKGREFF
LVKWKGYTESENTWEPLKNLKCPILLHQFRQDMKTALLEANKPLDSESLSAPIFAFLLQR
AKQRLKLQKWEDLMNQTCKQKGRIFICNEVDLDGPPKNFIYINENKLGKGVNVNPVIVGC
ECDDCFSQPVDGCCPGLLKHRRTYNDNRQVKVMPGVPIWECNSKCRCGPDCTNRVVQKGI
QYDLCIFKTANGRGWGVRTLQRIYKNSFVMEYLGEIITTEEAERRGVVYDKQGVTYLFDL
DYVDDVYTIDAAHYGNISHFVNHSCDPNLQVYNVFIDNLDERLPRIAFFAKRGIKAGEEL
TFDYKMTVDPIDAESSKMDSEFSRAGIEGSPIKRIHMECKCGVKTCRKYLF
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaagatttgaaagattgcagggtgtcttgcaaactttcatgggaggacctccag
gctctgtgccgcagagaaagacttgtttgcaaacagctgagtgtgacaaagaacaacttt
aatgactatgaagtggagtatctgtgtaactacaaaaaacacaagggtcgagagttcttc
ctggtcaagtggaaaggctacacggagtcagaaaacacatgggagcctctcaaaaatctt
aaatgccccatactgttacaccaattccgacaagacatgaagacggctctgcttgaggcc
aacaaaccgcttgattctgagtctttaagtgcccctatattcgccttccttctccagagg
gccaagcaacgtttgaagcttcagaaatgggaagacctcatgaaccagacctgcaagcag
aagggccgcatattcatctgcaatgaggtcgacctggacgggcctcctaagaacttcatc
tacattaatgagaataagttagggaaaggagtgaatgtgaatccagtgatagtgggctgt
gagtgtgatgattgcttctctcagccggttgatggctgctgtccagggctgctgaagcat
cggaggacatataatgacaacagacaggtgaaagtgatgcccggtgtgcctatctgggag
tgtaactccaagtgcagatgtggaccagactgtacaaacagggttgtgcaaaaaggtatt
cagtatgatctatgcatcttcaaaacagccaatggcagaggttggggagtgcggacgctg
cagaggatttacaaaaacagcttcgttatggagtatcttggagagatcatcacgacagag
gaagcagagaggagaggagtggtgtacgataagcaaggcgtcacctacctctttgatctg
gactatgtggatgacgtctacaccatcgatgcggctcattatggaaacatctctcacttt
gtcaaccacagctgcgatccaaacctgcaagtgtataatgtttttattgataacttggat
gagcgccttcccagaattgcattctttgcaaaacgagggatcaaagcaggagaagagctc
acctttgactacaaaatgactgttgatccaatagatgcagagagttccaaaatggattca
gaattcagtcgggctggaattgaaggatcacccatcaaacggatccatatggagtgcaag
tgtggagtaaagacctgccggaaatatctgttttaa

DBGET integrated database retrieval system