KEGG   Sinocyclocheilus grahami: 107550128Help
Entry
107550128         CDS       T04918                                 

Definition
(RefSeq) peptidase inhibitor 16-like
  KO
K20412  peptidase inhibitor 16
Organism
sgh  Sinocyclocheilus grahami
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:sgh04090]
    107550128
CD molecules [BR:sgh04090]
 Proteins
  107550128
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CAP
Motif
Other DBs
NCBI-GeneID: 107550128
NCBI-ProteinID: XP_016086842
LinkDB All DBs
Position
Unknown
AA seq 121 aa AA seqDB search
MKWLDFDWMVWDETLRLLAEAYAAKCIWDHNPQLKEFRMGENLFLGTGPFNATKAMMDWF
GEHADYDLETNNCPEDKMCGHYTQMVWADSNTIGCAAHFCDKLEHLDFEKATLFVCNYYP
Q
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggctggattttgactggatggtgtgggacgagacactgcgtctgctggcagaa
gcatatgcggcaaaatgcatctgggatcataaccctcaactaaaggaattcagaatgggt
gaaaatctctttttaggcactggaccatttaatgcaaccaaagcaatgatggactggttt
ggagagcacgcggattatgacttggaaaccaataactgtcctgaagataaaatgtgtggc
cattacactcagatggtctgggcagacagcaatacaattggctgtgctgcgcatttctgt
gacaaacttgagcatctggattttgagaaggccactcttttcgtgtgtaattactaccct
cagtaa

DBGET integrated database retrieval system