KEGG   Sinocyclocheilus grahami: 107550845Help
Entry
107550845         CDS       T04918                                 

Definition
(RefSeq) transmembrane protein 33-like
  KO
K20724  transmembrane protein 33
Organism
sgh  Sinocyclocheilus grahami
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sgh04131]
    107550845
   03036 Chromosome and associated proteins [BR:sgh03036]
    107550845
Membrane trafficking [BR:sgh04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   Others
    107550845
Chromosome and associated proteins [BR:sgh03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    107550845
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UPF0121
Motif
Other DBs
NCBI-GeneID: 107550845
NCBI-ProteinID: XP_016087732
LinkDB All DBs
Position
Unknown
AA seq 136 aa AA seqDB search
MADTEQRSPPPQSGPVQFLLSNKLETAMWLSRLFTVYCSIMFILPLLGHAVFLVIRWKDV
WFVIYSGQGSLLQPFIYYRFLTLRYSSRRNPYCRTLFTELRILLEHFVMKPSCPAFFRRM
CLNSIAFISRLAPTGV
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggcagacacagagcaaaggagtccacctcctcagtcaggccctgtgcaattcctcttg
agtaataagctggaaacagctatgtggctgtcacggctgttcactgtctactgctccatc
atgttcattctgccactgcttggccatgctgtgtttcttgtaataagatggaaggatgtt
tggtttgtgatttacagtggccaaggcagcttgcttcagccattcatctactacaggttt
ctcactctgcgctattcctcaagacgcaacccatattgccggactctgttcacggagctg
aggattttactggagcattttgtgatgaagcccagctgtccagccttcttcaggcggatg
tgcctcaacagcattgccttcattagccgccttgctcccaccggtgtctaa

DBGET integrated database retrieval system