KEGG   Sinocyclocheilus grahami: 107551158
Entry
107551158         CDS       T04918                                 

Definition
(RefSeq) G1/S-specific cyclin-D2-like
  KO
K10151  G1/S-specific cyclin-D2
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04068  FoxO signaling pathway
sgh04110  Cell cycle
sgh04115  p53 signaling pathway
sgh04218  Cellular senescence
sgh04310  Wnt signaling pathway
sgh04340  Hedgehog signaling pathway
sgh04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107551158
   04340 Hedgehog signaling pathway
    107551158
   04068 FoxO signaling pathway
    107551158
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107551158
   04115 p53 signaling pathway
    107551158
   04218 Cellular senescence
    107551158
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107551158
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C TFIIB
Other DBs
NCBI-GeneID: 107551158
NCBI-ProteinID: XP_016088155
LinkDB
Position
Unknown
AA seq 295 aa
MSVSLWCEEEEGQDRTQSSVRAPWDPSASGLRVIQRLLQSEERYLPSPLYISLIQREPQR
REELAKWTMEVCCECDCDESVFPLAVSLLDRYLSATLSLPVSPSCLAAACVLVASKLTES
DTVSADTLCAAAEYDFLSSNLWEMERVVLATLRWDVAAVTPQDFIPHFLRTLWELRDGDA
RTGDFLATLRRHGDTLVALCVCDSRFLGTPPSLVAAAALNSALRGLRAKSAGELSVMTSA
LATLCQTDVAVLQCCTELIEGALRERLRNGAHEEKDGDIEEERASTPTDLREIDF
NT seq 888 nt   +upstreamnt  +downstreamnt
atgtctgtgtctctgtggtgtgaggaggaagagggccaggacaggactcagtcttcagtc
cgagccccatgggaccccagcgcctccggactgagagttattcagagacttctgcagtcc
gaggagagatacctgccatctcctctctacatctctctcatccagagagaaccacagcgc
agagaggaactggccaagtggaccatggaggtgtgctgtgaatgtgactgtgatgagtct
gtatttcccctggctgtctccctgttggatcgatatctgtcggccactctatccctgcct
gtctctccatcctgtctggctgcagcttgtgttctggtggcctctaaattgacagaaagt
gacacagttagtgcagacacgctctgtgcggcagcagagtatgactttctctcatcaaac
ctgtgggaaatggagcgtgtggtgctggcgactctgcggtgggatgtggcagcagtgact
cctcaggacttcatcccacacttcttgcgcactctctgggaactccgggacggagacgcg
cgtacaggagactttctcgcaacgctgcgacgccacggcgatacacttgtcgccttgtgt
gtgtgtgactcgcgctttctgggaactcctccttcactggtggctgcggctgcactgaac
tctgccctgcggggtttaagggccaagagtgcgggagagctgagcgtcatgacctctgcc
ctggccacactctgtcagactgatgtggcggtgctgcagtgctgcactgagctgatagag
ggagctctcagggagagactgaggaatggagcacatgaggagaaagatggtgatattgaa
gaggaaagagccagcacacccacagacctaagagaaatagacttttaa

KEGG   Sinocyclocheilus grahami: 107563982
Entry
107563982         CDS       T04918                                 

Definition
(RefSeq) G1/S-specific cyclin-D2-like
  KO
K10151  G1/S-specific cyclin-D2
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04068  FoxO signaling pathway
sgh04110  Cell cycle
sgh04115  p53 signaling pathway
sgh04218  Cellular senescence
sgh04310  Wnt signaling pathway
sgh04340  Hedgehog signaling pathway
sgh04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107563982
   04340 Hedgehog signaling pathway
    107563982
   04068 FoxO signaling pathway
    107563982
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107563982
   04115 p53 signaling pathway
    107563982
   04218 Cellular senescence
    107563982
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107563982
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Other DBs
NCBI-GeneID: 107563982
NCBI-ProteinID: XP_016104438
UniProt: A0A672SV31
LinkDB
Position
Unknown
AA seq 295 aa
MSVSLWCEEEEGQDRTQSSVRAPWDPSASGLRVIHRLLQSEERYLPSPLYISLIQREPQR
REELAKWTMEACCECDCDGSVFPLAVSLLDRYLSATLSLPVSPSCLAAACVLVASKLTES
DTVSADALCAAAEYDFLSSNLREMERVVLATLRWDVAAVTPQDFIPHFLRTLGELKDRDV
HTGDFVATLRRHSDTLVAMCVCDSRFLGTPPSLVAAAALNSALRGLRAKSAGEQSVMTSA
LATLCQTDVAVLQCCTELIEGALRERLRNGAQEEKDEDIEDERASTPTDLREIDF
NT seq 888 nt   +upstreamnt  +downstreamnt
atgtctgtgtctctgtggtgtgaggaggaagagggccaggacaggactcagtcttcggtc
cgagccccatgggaccccagcgcctccggactgagggttattcacagacttctgcagtca
gaggagagatacctgccatctcctctctacatctctctcatccagagagaaccacagcgc
agagaggaactggccaagtggaccatggaggcgtgctgtgaatgtgactgcgatgggtct
gtatttcccctggctgtctccctgttggatcgatatctgtcggccactctatccctgcct
gtctcgccatcctgtctggctgcagcttgtgttctggtggcctcaaaactgacagaaagt
gacacagtgagtgcagatgcactctgtgctgcagcagagtacgactttctctcatcaaac
ctgcgggaaatggagcgtgtggtcctggcaactctgcggtgggatgtggcagcagtgacc
cctcaggactttatcccacacttcctgcgcacgctcggggagctcaaggatcgtgatgtg
catacaggagactttgtcgcaacgctgcggcgccacagcgatacactggttgccatgtgt
gtgtgtgactcgcgctttctgggaacacctccatcactggttgcagcggctgcactgaac
tctgccctgcggggtttgagagccaagagtgcaggagagcagagtgtcatgacctctgcc
ctggccacactctgtcagactgatgtggcggtgctgcagtgctgcactgagctgatagag
ggagctctcagggagagactgaggaacggagcacaggaggagaaagatgaggatattgaa
gatgaaagagccagcacacccacagacctaagagaaatagacttttaa

KEGG   Sinocyclocheilus grahami: 107572366
Entry
107572366         CDS       T04918                                 

Definition
(RefSeq) G1/S-specific cyclin-D2-like
  KO
K10152  G1/S-specific cyclin-D3
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04110  Cell cycle
sgh04115  p53 signaling pathway
sgh04218  Cellular senescence
sgh04310  Wnt signaling pathway
sgh04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107572366
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107572366
   04115 p53 signaling pathway
    107572366
   04218 Cellular senescence
    107572366
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107572366
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 107572366
NCBI-ProteinID: XP_016114284
LinkDB
Position
Unknown
AA seq 268 aa
MELFCHELVETDSSCRPVRAFRDAVLTRDSRVCQNLLSSERPSIKPGTESTDEQRYVRPI
LTGWMLQVCEDQKCEEEVFPLAVHYLDRHMSQNAVLRCRLQLLGCVCMFLASKLRESVPL
SAAKLCIYTDHAVTVPEILQWEVLLVSRLDWDLAAVLPSDFLEPLLQTLPLSAEDTASVR
RHTLSYIALSSTELKFSVFAPSAVACSCVTAAVIRLNVLKNEYGPDGLLQLLRDVLDTDM
VSLRSCFSSLEETINQVLPSPPEQDLPL
NT seq 807 nt   +upstreamnt  +downstreamnt
atggagttgttctgtcacgagcttgtcgagaccgactcgagctgcagaccggttcgggcg
ttcagagacgcggtcctgacccgagactcgcgcgtctgtcagaacctgctgagctcggag
agaccgagcatcaaacccggaaccgagtcgaccgacgagcagcgctacgtgcgcccaatc
ctaacgggatggatgctgcaggtgtgtgaggatcagaagtgtgaggaggaggtgtttcct
ctggccgttcattacctggacaggcacatgtcccagaatgccgtgctcaggtgccgtctg
cagctgctgggatgcgtctgcatgttcctggcctccaaactcagggaatcggttcctctg
agcgccgccaagctgtgcatctacaccgaccacgccgtcaccgtcccagagatcctgcag
tgggaggtgctgctggtgtcgcgtctggactgggatctggctgcggttctgccgtctgat
ttcttggagccgctgctgcagacgctgccgctgagcgccgaggacacggcatcggtccgg
agacacacgctctcctacatcgcgctgagctccacagagctgaagttctctgttttcgct
ccgtctgcggtggcctgctcgtgtgtgacggcagccgtgatcagactgaatgtcctaaag
aacgaatacggccctgacggcctgctgcagctgctgagagacgtcctggacacggacatg
gtgtccctgcgctcctgtttctcgtcgctggaggagaccatcaatcaggtgctgccgtct
ccgcccgagcaggacctcccgctctga

KEGG   Sinocyclocheilus grahami: 107572660
Entry
107572660         CDS       T04918                                 

Definition
(RefSeq) G1/S-specific cyclin-D2-like
  KO
K10151  G1/S-specific cyclin-D2
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04068  FoxO signaling pathway
sgh04110  Cell cycle
sgh04115  p53 signaling pathway
sgh04218  Cellular senescence
sgh04310  Wnt signaling pathway
sgh04340  Hedgehog signaling pathway
sgh04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107572660
   04340 Hedgehog signaling pathway
    107572660
   04068 FoxO signaling pathway
    107572660
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107572660
   04115 p53 signaling pathway
    107572660
   04218 Cellular senescence
    107572660
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107572660
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C Herp-Cyclin
Other DBs
NCBI-GeneID: 107572660
NCBI-ProteinID: XP_016114581
UniProt: A0A672QCV3
LinkDB
Position
Unknown
AA seq 298 aa
MELLCLEMDTIIRALPDPNLLYDDRVLQSLLTIEERFLPQCSYFKCVQKEIQPFMRRMVA
TWMLEVCEEQKCEEEVFPLAMNYLDRFLSVVPTRKCNLQLLGAVCMFLASKLKETRPLTA
EKLCIYTDNSIRPQELLEWELVVLGKLKWNLAAVTPNDFIEHIMRKLPLPEDKLDLIRKH
VQTFIALCATDFNFVMHPPSMIATGSVAAAICGLQLNSTNRSLWGDNLTELLAKITNTEV
DLLKACQEQIERVLMNNLREGRRQQQKQQQQEQGGPRGKALDDQDQSSTPTDVRDINL
NT seq 897 nt   +upstreamnt  +downstreamnt
atggaactgctttgtctcgagatggacaccattataagagcccttcctgacccgaatctt
ctatatgatgacagggtactacagagcttgttgaccatcgaagagaggtttcttccccag
tgttcatattttaaatgcgttcagaaagaaattcagccctttatgcggaggatggtggca
acttggatgttggaggtctgcgaggaacagaaatgcgaggaagaagtttttccactggct
atgaactacttggaccgatttttatcggtggtaccaacaagaaaatgtaacttgcagttg
ctcggcgcagtgtgcatgtttcttgcgtctaaattgaaagagacgcgtccattaactgca
gagaagctgtgcatctacactgataactcaatcagaccgcaggaactgctggaatgggag
ctggttgttctgggcaaattgaagtggaatctggctgctgtcactcccaatgactttatt
gagcacattatgaggaaacttccgctgcctgaggataaactggacctgatccgtaaacat
gtgcagactttcatcgccctttgtgcaacagatttcaactttgtcatgcaccctccatcc
atgattgcaacgggaagcgtggcagcagctatctgtggcctgcagcttaacagcactaac
cgctcactgtggggagacaacctaacagagttactcgccaagatcacaaacacagaagtt
gatctgttaaaggcatgccaggagcagattgaaagagtgttgatgaataacctgagggag
ggccgccggcagcagcagaaacagcagcagcaggaacagggtggcccgcgcggcaaagca
cttgatgaccaagaccagtccagcaccccaaccgatgtacgagacatcaacttgtga

KEGG   Sinocyclocheilus grahami: 107575166
Entry
107575166         CDS       T04918                                 

Definition
(RefSeq) G1/S-specific cyclin-D2-like
  KO
K10151  G1/S-specific cyclin-D2
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04068  FoxO signaling pathway
sgh04110  Cell cycle
sgh04115  p53 signaling pathway
sgh04218  Cellular senescence
sgh04310  Wnt signaling pathway
sgh04340  Hedgehog signaling pathway
sgh04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107575166
   04340 Hedgehog signaling pathway
    107575166
   04068 FoxO signaling pathway
    107575166
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107575166
   04115 p53 signaling pathway
    107575166
   04218 Cellular senescence
    107575166
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107575166
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C FliG_C Herp-Cyclin
Other DBs
NCBI-GeneID: 107575166
NCBI-ProteinID: XP_016117074
UniProt: A0A672SUF8
LinkDB
Position
Unknown
AA seq 298 aa
MELLCLEMDTIIRALPDPNLLYDDRVLQSLLTIEERFLPQCSYFKCVQKDIQPFMRRMVA
TWMLEVCEEQKCEEEVFPLAMNYLDRFLAVVPTRKCNLQLLGAVCMFLASKLKETRPLTA
EKLCIYTDNSIRPQELLEWELVVLGKLKWNLAAVTPNDFIEHIMRKLPLPEDKLDLIRKH
VQTFIALCATDFTFAMYPPSMIATGSVAAAICGLQLNSTNRSLWGDNLTELLAKITNTEV
DVLKECQEQIERVLMNNLSEGRRQQQKQQQQEQGGPRSKALDDQDQSSTPTDVRDINL
NT seq 897 nt   +upstreamnt  +downstreamnt
atggaactgctttgtctcgagatggacaccattataagagcccttcctgacccgaatctt
ctatatgatgacagggtactacagagcttgttgaccatcgaagagaggtttcttccccag
tgttcatattttaaatgcgttcagaaagacattcagccctttatgcggaggatggtggca
acttggatgttggaggtctgcgaggaacagaaatgcgaggaagaggtttttccactggct
atgaactacttggaccgatttttagctgtggtaccaacaagaaaatgcaacttgcagttg
cttggcgcagtgtgcatgtttcttgcgtctaaattgaaagagacgcgtccattaactgca
gagaagctgtgcatctacactgataactcaatcagaccgcaggaactgctggaatgggag
ctggttgtcctgggcaaattgaagtggaatctggctgctgtcactcccaatgactttatt
gagcacattatgaggaaacttccgctgcctgaggataagctggacctgatccgtaaacat
gtgcagactttcatcgccctttgtgcaacagatttcacttttgccatgtaccctccatcc
atgattgcaacgggcagcgtggcagcggctatttgtggcctgcagcttaacagcactaac
cgctcactgtggggagacaacctaacagaattactcgccaagatcacaaacacagaagtt
gatgtgttaaaggaatgccaggagcagattgagagagtgttgatgaataacctgagtgag
ggtcgccggcaacagcagaaacagcagcagcaggaacagggtggcccccgcagcaaagca
cttgatgaccaagaccagtccagcaccccaaccgatgtacgagacatcaacttgtga

KEGG   Sinocyclocheilus grahami: 107579638
Entry
107579638         CDS       T04918                                 

Definition
(RefSeq) G1/S-specific cyclin-D2-like
  KO
K10151  G1/S-specific cyclin-D2
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04068  FoxO signaling pathway
sgh04110  Cell cycle
sgh04115  p53 signaling pathway
sgh04218  Cellular senescence
sgh04310  Wnt signaling pathway
sgh04340  Hedgehog signaling pathway
sgh04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107579638
   04340 Hedgehog signaling pathway
    107579638
   04068 FoxO signaling pathway
    107579638
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107579638
   04115 p53 signaling pathway
    107579638
   04218 Cellular senescence
    107579638
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107579638
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Other DBs
NCBI-GeneID: 107579638
NCBI-ProteinID: XP_016120932
LinkDB
Position
Unknown
AA seq 292 aa
MELFCLEKDAIMRAQRDPNIFCDERVLQSLLTVEDRYVPQRPYFKCVQKEIQPFMRRMVA
TWMLEVCEEEKCEEDVFPLAMNYLDRFLAAVPTRKCYLQLLGAVCLFLASKLKACQPLSA
RKLCMYTDNSITSQQLLEWELVVLSKLKWNLAAITPLDFIEHILHKLPFPEDRLTLIRKH
AQTFIALCATDHSFTMYPPSMIATGCVGAAVCGLQPDQSNQNLWGDNLTELLAKITHTEV
DCLKSCQEQIEQLLTSSLKESQQQQQEGRVSNKGTQSQNLSCTPTDVRDVNL
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaacttttttgcttggaaaaggacgcaatcatgcgagctcagagagatcccaacatc
ttctgcgatgaaagagtactgcaaagtcttttaacggtggaggacagatatgttccgcag
agaccctattttaaatgtgtccagaaggaaattcagccttttatgaggcggatggtcgcg
acgtggatgctggaggtttgtgaagaggagaaatgtgaagaggatgtctttcccttggct
atgaactacctggacagatttttagctgcagttcctacaagaaaatgttatttgcagctc
ttaggggccgtgtgtctcttcctggcttcaaaattaaaagcatgccaaccgctgtcggcc
aggaagctctgcatgtacaccgacaactccattacatctcaacaactgctggagtgggag
ttggtggttcttagtaaattgaaatggaacctggctgccatcaccccacttgactttatt
gaacacatcctgcacaaactgccctttcccgaagacagactgacactgatccgcaaacac
gcgcaaaccttcatcgccctctgtgcaacagatcacagcttcaccatgtaccctccctcc
atgatcgctacaggatgtgtgggggcagcagtatgtggcctccagcctgaccagagcaat
cagaatctgtggggggacaatctgacggagctgctggctaaaatcacccacactgaggtg
gactgtctgaaatcatgtcaagagcagatcgagcagttactgaccagcagcctgaaagaa
agtcaacaacagcaacaggagggcagagtcagcaacaaagggacgcaatctcaaaacctg
tcctgcacccctacagatgtccgtgatgttaacttatga

KEGG   Sinocyclocheilus grahami: 107583977
Entry
107583977         CDS       T04918                                 

Definition
(RefSeq) G1/S-specific cyclin-D2-like isoform X1
  KO
K10151  G1/S-specific cyclin-D2
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04068  FoxO signaling pathway
sgh04110  Cell cycle
sgh04115  p53 signaling pathway
sgh04218  Cellular senescence
sgh04310  Wnt signaling pathway
sgh04340  Hedgehog signaling pathway
sgh04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107583977
   04340 Hedgehog signaling pathway
    107583977
   04068 FoxO signaling pathway
    107583977
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107583977
   04115 p53 signaling pathway
    107583977
   04218 Cellular senescence
    107583977
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107583977
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Other DBs
NCBI-GeneID: 107583977
NCBI-ProteinID: XP_016125854
UniProt: A0A672RJX6
LinkDB
Position
Unknown
AA seq 295 aa
MELFCLEKDSIMRAQRDPNIFCDERVLQSLLTVEDRYVPQGPYFKCVQKDIQPFMRRMVA
TWMLEVCEEEKCEEDVFPLAMNYLDRFLAAVPTRKCYLQLLGAVCLFLASKLKACQPLSA
RKLCMYTDNSITSQQLLEWELVVLSKLKWNLAAITPLDFIEHILHKLPFPEDRLTLIRKH
TQTFIALCATDHSFTMYPPSMIATGCVGAAVCGLQPDQSNQNLWGDSLTELLAKITHTEL
DCLKSCQEQIEQLLTNSLKESQQQHQQQQEGRASSKGTQSQNLSCTPTDVRDVNL
NT seq 888 nt   +upstreamnt  +downstreamnt
atggaacttttttgcttggaaaaggactcaatcatgcgagctcagagagatcccaacatc
ttttgcgatgaaagagtattgcaaagtcttttaacagtggaggacagatatgttccgcag
ggaccctattttaaatgtgtccagaaggatattcagccttttatgaggcggatggtcgcg
acgtggatgttggaggtgtgtgaagaggagaaatgtgaagaggatgtctttcccttggct
atgaactacctggacagatttttagctgcggttcctacaagaaaatgttatctgcagctc
ttaggggccgtgtgtctcttcttggcttcaaaattaaaagcatgccaaccgctgtcggcc
aggaagctctgcatgtacacagacaactccattacatctcaacaactgctggagtgggag
ttggtggttcttagtaaattgaaatggaacctggctgccatcaccccacttgactttatc
gaacacattctgcacaaactgcccttccctgaagacagactgacgctgatccgcaaacac
acgcaaaccttcatcgccctctgtgcaacagatcacagcttcaccatgtaccctccctcc
atgatcgccacaggatgtgtgggggcagcagtatgtggcctccagcccgaccagagcaac
caaaatctgtggggggacagtctgacggagctgctggctaaaatcacccacactgagctg
gactgtctgaagtcatgtcaagagcagatcgagcagttactgaccaacagcctgaaagaa
agtcaacaacagcatcaacagcaacaggagggcagagccagcagcaaagggacgcaatct
caaaacctgtcctgcacccctacagatgtccgtgatgtcaacttatga

KEGG   Sinocyclocheilus grahami: 107584710
Entry
107584710         CDS       T04918                                 

Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04068  FoxO signaling pathway
sgh04110  Cell cycle
sgh04115  p53 signaling pathway
sgh04218  Cellular senescence
sgh04310  Wnt signaling pathway
sgh04340  Hedgehog signaling pathway
sgh04371  Apelin signaling pathway
sgh04510  Focal adhesion
sgh04530  Tight junction
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107584710
   04340 Hedgehog signaling pathway
    107584710
   04371 Apelin signaling pathway
    107584710
   04068 FoxO signaling pathway
    107584710
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107584710
   04115 p53 signaling pathway
    107584710
   04218 Cellular senescence
    107584710
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107584710
   04530 Tight junction
    107584710
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 107584710
NCBI-ProteinID: XP_016126903
UniProt: A0A672M298
LinkDB
Position
Unknown
AA seq 292 aa
MEHQLFCCEVDTIRRAYQDSNLLNDRVLQTMLKAEENYLPSPNYFKCVQKEIVPKMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSVEPTKKTRLQLLGATCMFLASKMKETVPLT
AEKLCIYTDNSVRPSELLQMELLALNKLKWDLASVTPHDFIEHFLAKLPIHQSSKQILRK
HAQTFVALCATDVNFIASPPSMIAAGSVAAAVQGLYLKSSDSCLSSQNLTSFLSQVIRSD
PDCLRSCQEQIESLLESSLRQAQQHNISTETKRVEEDVDLSCTPTDVRDINI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaacaccagttgttttgctgtgaagtggataccattagaagagcttaccaagatagc
aacctgttgaatgaccgagttttacagacaatgctcaaagcagaggaaaactatcttcca
tctccaaattatttcaagtgtgtgcagaaagaaattgtacctaaaatgaggaaaatcgtc
gccacatggatgctcgaggtctgtgaagagcagaaatgcgaagaggaagtttttccgttg
gctatgaactacctggacagatttttatctgtggagcccaccaaaaagaccagattacag
ctgttaggagcaacttgtatgtttttggcctctaagatgaaagagactgtgccactaaca
gcagagaagttgtgcatatacacggacaactccgtccgtcccagcgaattattgcaaatg
gaactgctggcgctaaataaactgaaatgggatctggcctcagtgacaccacatgatttc
attgaacatttcctcgccaaactgcctatacatcagagctccaagcagatactgcgcaag
cacgcccagacgtttgtggccctctgtgcaacagatgtcaacttcatcgcaagccctcca
tccatgattgcggccggcagcgttgcagcagcagtgcaggggttgtacctcaaaagcagc
gacagttgcctctcgtcccagaacctcaccagcttcctctcacaagtcatcagaagcgac
cctgactgtctgcgatcgtgtcaggaacagatcgagtccctgctggaatctagtctcaga
caagctcagcagcacaacatctccacagagaccaaaagagtggaggaggacgtggacctc
tcttgcactcccacagatgtcagagacattaatatctga

KEGG   Sinocyclocheilus grahami: 107594473
Entry
107594473         CDS       T04918                                 

Definition
(RefSeq) G1/S-specific cyclin-D1-like
  KO
K04503  G1/S-specific cyclin-D1
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04068  FoxO signaling pathway
sgh04110  Cell cycle
sgh04115  p53 signaling pathway
sgh04218  Cellular senescence
sgh04310  Wnt signaling pathway
sgh04340  Hedgehog signaling pathway
sgh04371  Apelin signaling pathway
sgh04510  Focal adhesion
sgh04530  Tight junction
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107594473
   04340 Hedgehog signaling pathway
    107594473
   04371 Apelin signaling pathway
    107594473
   04068 FoxO signaling pathway
    107594473
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107594473
   04115 p53 signaling pathway
    107594473
   04218 Cellular senescence
    107594473
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107594473
   04530 Tight junction
    107594473
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 107594473
NCBI-ProteinID: XP_016140018
UniProt: A0A672KT72
LinkDB
Position
Unknown
AA seq 292 aa
MEHQLFCCEVDTIRRAYQDSNLLNDRVLQTMLKAEENYLPSPNYFKCVQKEIAPKMRKIV
STWMLEVCEEQKCEEEVFPLAMNYLDRFLSVEPTKKTRLQLLGATCMFLASKMKETVPLT
AEKLCIYTDNSVRPSELLQMELLALNKLKWDLASVTPHDFIEHFLAKLPIHQSSKQILRK
HAQTFVALCATDVNFIASPPSMIAAGSVAAAVQGLYLKSSDSCLSSLNLTNFLSQVIRCD
PDCLRSCQEQIESLLESSLRQAQQHNISTETKRVEEDVDLSCTPTDVRDINI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaacaccagttgttttgctgtgaagtggataccattagaagagcttaccaagatagc
aacctgttgaatgaccgagttttacagacaatgctcaaagcagaggaaaactatcttcca
tcaccaaattatttcaagtgtgttcagaaagaaatcgcacctaaaatgaggaaaatcgtc
tccacatggatgctcgaggtctgtgaagaacagaaatgcgaagaggaagtttttccgttg
gctatgaactacctggacagatttttatctgtggagcccaccaaaaagaccaggttacag
ctgttaggggcaacttgtatgtttttggcctctaagatgaaagagactgtgccactaaca
gcagagaagttgtgcatatacacggacaactccgtccgtcccagtgaattattgcaaatg
gaactgctggcactaaataaactgaagtgggatcttgcctcagtcacaccacatgatttc
attgaacacttcctcgccaaactgcctatacaccagagctccaagcagatattgcgcaag
cacgcccagacgtttgtggccctctgtgcaacagatgttaacttcatcgcaagccctcca
tccatgatcgcggccggcagcgttgcagcagcagtgcaggggttgtacctgaaaagcagc
gacagttgcctctcatccctgaacctcaccaacttcctctcacaagtcatcagatgtgac
cctgactgtctgcgatcgtgtcaggaacagatcgagtccctgctggaatctagtctcaga
caagctcagcagcacaacatctccacagagaccaaaagagtggaggaggacgtggacctc
tcttgcactcccacagacgtcagagacattaatatctga

DBGET integrated database retrieval system