KEGG   Sinocyclocheilus grahami: 107551196
Entry
107551196         CDS       T04918                                 

Definition
(RefSeq) TGF-beta receptor type-2-like
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04060  Cytokine-cytokine receptor interaction
sgh04068  FoxO signaling pathway
sgh04144  Endocytosis
sgh04218  Cellular senescence
sgh04350  TGF-beta signaling pathway
sgh04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107551196
   04350 TGF-beta signaling pathway
    107551196
   04068 FoxO signaling pathway
    107551196
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107551196
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107551196
  09143 Cell growth and death
   04218 Cellular senescence
    107551196
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    107551196
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sgh01001]
    107551196
Enzymes [BR:sgh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     107551196
Protein kinases [BR:sgh01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   107551196
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase Pkinase_fungal
Other DBs
NCBI-GeneID: 107551196
NCBI-ProteinID: XP_016088223
UniProt: A0A672LSU0
LinkDB
Position
Unknown
AA seq 562 aa
MAQYWLSLLCWGTFLISSAVMDRSGVDGMYPLYNPIRIRQLCKFCDVEASDCKGTGTCES
NCSITSICAHAEEICVAIWRKSEDNNTIETLCHNPSEPLYGIMVENYNNTKCEIKKRMSN
RGPFHICSCNAEECNDILMFTLPIGPDPTNNQVVLVILVSLLPLLVLAVLVIASFYWYRM
YRRRKLDEWETKKPSKRKGPKGPLDCSDACAIMMDDDRSDSSSTHANNLNHNTEPLPIEL
DLQVGKGRFAEVYKAKLRQSPSEQFETVAVKIFPYEEYASWKNEKDIFSDIDLKHENILH
FLTAEERKVEKQYWLITAYHPRGNLQEYLTRHLISWEDLRLLGGSLAWGVAHLHSDHTPC
GRPKVPIVHRDLKSTNILVKNDLTCCLCDFGLGLRLDNSLTVDDLANSGQVGTARYMAPE
VLESRINLENIESFKQTDVYSMALVLWEITSRCNAIGEVKDYEPPFGSKVREHPCVESMK
DNVLRDRGRPEIPSSWMKHQGVAAVCTTINECWDHDPEARLTAQCVAERFNEMDDDLDKL
STCSSSEEKIPEDCSVSVSDDK
NT seq 1689 nt   +upstreamnt  +downstreamnt
atggcgcaatactggctttctctgctctgttgggggacttttttgatttcttcggctgtc
atggatcggagcggagtcgatgggatgtatcctttatataatccaatacggattcgtcaa
ctgtgtaagttctgtgacgtggaggcatccgactgtaaaggcaccggcacctgtgaaagc
aactgcagcatcacatccatctgtgcccatgccgaagaaatctgtgtggctatctggagg
aagagcgaggacaacaacacgattgagacgttgtgccacaatccatctgagcccctctac
ggcatcatggtggagaactacaacaacaccaagtgtgaaataaaaaagaggatgtcaaac
agaggccccttccacatctgctcctgcaacgccgaggagtgcaacgacatactgatgttc
acgctccctattggtccagaccctacaaataaccaggtggtgttggtgatcctggtcagt
ttgctgcccctcctggttctggctgtgctggtcatcgcctccttctactggtatcgcatg
taccgtcgccgcaaactcgatgagtgggagaccaagaagccgtccaaacgcaagggaccc
aaaggcccgttggactgtagcgacgcctgcgccatcatgatggacgatgaccgctccgac
agcagctccacacatgccaacaatctcaaccacaacacagaacctctgcccatcgagctg
gaccttcaggtgggcaagggccgctttgccgaggtttacaaagccaagctgagacaaagc
ccctcggaacagtttgagacggtggcagtgaagatcttcccctacgaagagtacgcatcc
tggaagaatgaaaaggacatcttctcagacatcgatctgaagcacgagaatattctgcac
ttcctgacggcagaggagaggaaggtggagaaacagtactggctgatcaccgcctatcat
ccacgcgggaacctgcaggagtacctcacgcgacacctcatcagctgggaggatctgcgg
ctgctcgggggttcactcgcctggggtgtggctcatttgcatagtgaccacacaccttgt
gggcggcccaaagtgcccatcgttcaccgagatctgaagagcactaacatcctggtgaag
aatgacctcacttgttgcctctgtgactttggacttggcctccgccttgacaactcgctg
acagtggatgacttggccaacagtggacaggtgggtacagccaggtacatggctccagaa
gtgctggaatcaaggatcaaccttgagaacatcgagtcattcaagcaaaccgatgtctac
tccatggccctggtgctgtgggagatcacgtccaggtgtaatgccatcggagaggttaaa
gactacgaacctccatttggctctaaagtccgagagcacccctgtgtggagagcatgaaa
gacaatgtgctgagagaccggggcagaccagagattcccagcagctggatgaaacaccag
ggtgtggctgcagtctgtaccaccatcaacgagtgctgggatcacgaccctgaagcccgg
ctcacggcacagtgtgtggccgaacgcttcaacgagatggacgacgacctagacaagctg
tcaacctgcagtagctctgaggagaagattccagaagattgctccgtgagcgtgagcgat
gacaaatga

DBGET integrated database retrieval system