KEGG   Sinocyclocheilus grahami: 107552016
Entry
107552016         CDS       T04918                                 

Definition
(RefSeq) beta-TrCP-like
  KO
K03362  F-box and WD-40 domain protein 1/11
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04114  Oocyte meiosis
sgh04120  Ubiquitin mediated proteolysis
sgh04218  Cellular senescence
sgh04310  Wnt signaling pathway
sgh04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107552016
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107552016
   04340 Hedgehog signaling pathway
    107552016
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107552016
   04218 Cellular senescence
    107552016
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sgh04121]
    107552016
   03036 Chromosome and associated proteins [BR:sgh03036]
    107552016
Ubiquitin system [BR:sgh04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     107552016
Chromosome and associated proteins [BR:sgh03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     107552016
SSDB
Motif
Pfam: WD40 Beta-TrCP_D ANAPC4_WD40 Nup160 WD40_like DUF1513 DUF4508
Other DBs
NCBI-GeneID: 107552016
NCBI-ProteinID: XP_016089312
LinkDB
Position
Unknown
AA seq 334 aa
MEPEMEDKPLELMNFSVMDSQTADRSPKITLIKVSNGPLTGSRKRPSEGNYEKEKDVCIQ
LFDQWSEADQVEFVEHLISRMCHYQHGHINSYLKPMLQRDFITALPGNTHRVLILKMPFL
MEGNMCVCIQIWDKQTLECLKILTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNSGEVL
NTLIHHNEAVLHLRFCNGLMVTCSKDRSIAVWDMASPTDISLRRVLVGHRAAVNVVDFDD
KYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECG
ACLRVLEGHEELVRCIRFDNKRIVSGAYDGYACV
NT seq 1005 nt   +upstreamnt  +downstreamnt
atggagccggagatggaggacaaacccttagagctgatgaacttctctgtcatggactcg
cagactgcagaccgctccccaaagatcacattaattaaggtgagtaatggacctttgaca
ggctctaggaagcggccgtcagagggaaattacgagaaggagaaggacgtgtgcatccag
ctctttgatcagtggtctgaggcagaccaggtggagtttgtggaacacctgatctcacgc
atgtgccattaccaacacggccacataaactcctacctcaaacccatgctccaaagggac
ttcattacagcactgccaggtaacacacacagagtccttattctgaaaatgccatttctg
atggagggtaatatgtgtgtttgcattcagatatgggataaacagactctggagtgtttg
aagattctgacgggacacacaggctctgtgctgtgtctgcaatacgatgagagagtcatt
gttaccggctcctctgattccactgtcagagtgtgggatgtgaactcgggggaggttctg
aacacactgatccaccacaacgaggccgtgctccacctgcgattctgtaatgggctgatg
gtcacctgctcgaaggatcgctccatcgccgtgtgggacatggcctctcctacggacatc
agtctccgccgggtcctcgtcggacacagggctgccgtcaatgtggtcgactttgacgac
aagtacattgtctctgcctctggggatcggaccataaaggtgtggagtacaagcacctgt
gagtttgttcggacactaaacggtcacaagcgaggaattgcctgcctgcagtacagagat
agactcgtggtcagcggctcctcagacaacaccatcaggctgtgggatatcgagtgtgga
gcttgtttgcgggttttggaagggcacgaggagcttgttcgctgtattcgctttgataac
aagcggatcgtgagtggagcgtatgacgggtacgcctgtgtctga

KEGG   Sinocyclocheilus grahami: 107586136
Entry
107586136         CDS       T04918                                 

Definition
(RefSeq) F-box/WD repeat-containing protein 11
  KO
K03362  F-box and WD-40 domain protein 1/11
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04114  Oocyte meiosis
sgh04120  Ubiquitin mediated proteolysis
sgh04218  Cellular senescence
sgh04310  Wnt signaling pathway
sgh04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107586136
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107586136
   04340 Hedgehog signaling pathway
    107586136
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107586136
   04218 Cellular senescence
    107586136
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sgh04121]
    107586136
   03036 Chromosome and associated proteins [BR:sgh03036]
    107586136
Ubiquitin system [BR:sgh04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     107586136
Chromosome and associated proteins [BR:sgh03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     107586136
SSDB
Motif
Pfam: WD40 Beta-TrCP_D ANAPC4_WD40 F-box-like WD40_like F-box Nup160 WD40_2 DUF4508
Other DBs
NCBI-GeneID: 107586136
NCBI-ProteinID: XP_016128862
LinkDB
Position
Unknown
AA seq 533 aa
MFQIFPLPNPFQYRFFFLVSSNIFIYLFFLLRFSQPTFICPQVSNGPLTGSRKRPSEGNY
EKEKDVCIQLFDQWSEADQVEFVEHLISRMCHYQHGHINSYLKPMLQRDFITALPAQGLD
HIAENILSFLDARSLCSAELVCKEWQRVISEGMLWKKLIERMVRTDPLWKGLSERHQWEK
YLFKNRTTEVPPNSYYRSLYPKIIQDIETIEANWRCGRHNLQRIQCRSENSKGVYCLQYD
DEKIISGLRDNSIKIWDKQTLECLKILTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNS
GEVLNTLIHHNEAVLHLRFCNGLMVTCSKDRSIAVWDMASPTDISLRRVLVGHRAAVNVV
DFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWD
IECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLV
EHSGRVFRLQFDEFQIISSSHDDTILIWDFLNVSTNGQTEGRSPSRTYTYISR
NT seq 1602 nt   +upstreamnt  +downstreamnt
atgtttcagattttccctttgcccaatcctttccaatacagatttttttttttggtctca
tctaatatatttatttatttgtttttccttttacgattctcccagcctacttttatctgt
cctcaggtgagtaatggacccttgacaggctctaggaagcggccgtcagaggggaattac
gagaaggagaaggatgtgtgcatccagctctttgatcagtggtctgaggcggaccaggtg
gagtttgtggaacacctgatctcacgaatgtgccattaccaacatggccacataaactcc
tacctcaaacccatgctccaaagggacttcattacggcactgccagctcagggtctggat
catatagcagagaacatcttgtccttcctggacgcacgctcgctttgttcggctgagctg
gtgtgtaaagaatggcagcgtgtgatatccgaaggcatgttgtggaagaagctgatcgag
aggatggttcggacagacccactgtggaagggcctttcagagagacaccagtgggaaaaa
taccttttcaagaaccgcacaacagaagttcctccaaactcatactaccgctctctttat
ccaaaaatcattcaggacattgagaccatcgaggcaaactggaggtgtggccgacataac
ctgcagaggatccagtgtagatcagagaacagcaaaggtgtttactgtctccagtatgat
gacgaaaagatcatcagcggtctacgcgataactccatcaagatatgggataaacagact
ctggagtgtttgaagatccttacggggcacacaggctctgtgctgtgtctgcaatatgat
gagagagtcattgttaccggctcttctgattccactgtcagagtgtgggatgtgaactcg
ggggaggttctgaacactttgatccatcacaatgaggctgtgctccacctgcgattctgt
aacgggctgatggtcacctgctcgaaggatcgctccatcgccgtgtgggacatggcctct
cctactgacatcagtcttcgccgggtcctcgtcggacacagggctgccgtcaatgtggtc
gactttgacgacaagtacattgtctctgcctctggggatcggaccataaaggtgtggagt
acaagcacctgtgagtttgttcggacactaaatgggcataagcgaggaattgcctgcctg
cagtacagagacagacttgtggtcagtggctcctcagacaacaccatcaggctgtgggat
attgagtgtggagcttgcttgcgggttttggaagggcacgaagaacttgttcgctgtatt
cgctttgataacaagcggatcgtgagtggagcgtatgacggtaaaattaaagtatgggac
ctacaagctgctctcgatccacgagccccagccagcactctgtgtctacgtacactagtg
gaacattctggccgagtgttccggctccaattcgatgagttccagatcatcagcagttcc
cacgatgacactatccttatctgggacttcctcaatgtgtcgaccaacgggcagacggaa
ggacgatcgccgtcccgcacgtatacctatatatccagatag

KEGG   Sinocyclocheilus grahami: 107588312
Entry
107588312         CDS       T04918                                 

Definition
(RefSeq) F-box/WD repeat-containing protein 11
  KO
K03362  F-box and WD-40 domain protein 1/11
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04114  Oocyte meiosis
sgh04120  Ubiquitin mediated proteolysis
sgh04218  Cellular senescence
sgh04310  Wnt signaling pathway
sgh04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107588312
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107588312
   04340 Hedgehog signaling pathway
    107588312
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107588312
   04218 Cellular senescence
    107588312
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sgh04121]
    107588312
   03036 Chromosome and associated proteins [BR:sgh03036]
    107588312
Ubiquitin system [BR:sgh04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     107588312
Chromosome and associated proteins [BR:sgh03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     107588312
SSDB
Motif
Pfam: WD40 Beta-TrCP_D ANAPC4_WD40 F-box-like WD40_like F-box Nup160
Other DBs
NCBI-GeneID: 107588312
NCBI-ProteinID: XP_016131839
UniProt: A0A672STR0
LinkDB
Position
Unknown
AA seq 527 aa
MDPDMEDKTLELMSMTVMESQNNTGDVSPKKTTVFKFGNGSVAGSRKRMSQGNFEKEKDL
CIQLFDQWSESDQVEFVEHLISRMCHYQHGHINSYLKPMLQRDFITALPAQGLDHIAENI
LSFLDARSLCSAELVCREWQRVISDGMLWKKLIERMVRTDPLWKGLSERHQWEKYLFKNR
TNEVPPNSYYHSLYPKIIQDIETIEANWRCGRHNLQRIQCRSENSKGVYCLQYDDDKIIS
GLRDNSIKIWDKQSLECLKVLTGHTGSVLCLQYDDRVIVTGSSDSTVRVWDVVSGEVLNT
LIHHNEAVLHLRFCNGLMVTCSKDRSIAVWDMASATDISLRRVLVGHRAAVNVVDFDDKY
IVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGAC
LRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRV
FRLQFDEFQIISSSHDDTILIWDFLNVSTNGQPERRSPSRTYTYVSR
NT seq 1584 nt   +upstreamnt  +downstreamnt
atggacccggacatggaggacaaaaccctggagctgatgagcatgacggtgatggagtca
cagaataacacaggtgacgtctcaccaaagaagacaacagtgttcaagttcgggaatggt
tcagtagcgggttcgaggaagaggatgtcacaggggaacttcgagaaggagaaagatctg
tgcatccagctgtttgatcagtggtccgaatcggatcaggtggagtttgtggagcatctg
atctcacgcatgtgtcactaccagcacggccatataaactcgtaccttaaacccatgtta
cagagagacttcatcaccgcgttgccagctcagggtctggatcacatagcggagaacatc
ctctcgtttctcgacgctcgttctctgtgctctgctgagctggtctgtcgagaatggcag
cgggtcatttcagacgggatgctctggaagaagctcatcgagaggatggtgcgcacagac
ccgctgtggaaaggcctgtcagagcgccaccagtgggagaaatatttatttaagaaccga
acaaacgaggttccgcccaattcatactaccattcactctatcccaaaattatacaagac
attgagactattgaagcaaactggcgttgtggacgtcacaatctccagcggattcagtgc
cggtcagagaacagtaaaggtgtttactgccttcagtacgacgatgacaagatcatcagc
ggcctgcgagacaactccatcaaaatctgggacaaacagtctctggagtgtctgaaggtc
ctgacgggtcacactggctcagttctgtgtctgcagtacgatgacagagtcatagtgacg
ggctcctctgattcgactgtcagggtgtgggatgttgtttctggtgaggttctcaacact
ctgatccatcacaacgaggcggttctgcacctgcgcttctgtaacggtctcatggtgacg
tgttcgaaagatcgctccatcgcggtgtgggacatggcgtctgcaaccgacatcagcctg
cgccgcgtgctcgtgggtcaccgcgccgccgtcaacgtggtggacttcgatgacaaatac
attgtgtctgcgtctggagacagaaccataaaagtgtggagcacaagcacgtgtgagttt
gtacggacgcttaatggtcacaagcgtggcatcgcttgccttcagtacagagacagactc
gtggtcagcgggtcctcggacaacaccatcagactgtgggacattgagtgtggcgcttgt
ctgcgtgtgctggagggtcatgaggagctcgtgcgctgcatcagattcgacaacaagagg
atcgtgagcggagcatatgatgggaaaattaaagtttgggatttacaggctgctctggat
cctcgggcccccgccagcacattatgtctgcgtacactcgtggagcattctgggcgtgtg
ttccgactgcagtttgatgagttccagattattagcagttcccatgacgacacgatcctt
atatgggacttcctgaacgtctccaccaatggccagccggagaggcgttcgccctcacgg
acatatacatacgtctccagatag

DBGET integrated database retrieval system