KEGG   Sinocyclocheilus grahami: 107553101Help
Entry
107553101         CDS       T04918                                 

Definition
(RefSeq) mothers against decapentaplegic homolog 3
  KO
K23605  mothers against decapentaplegic homolog 3
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04068  FoxO signaling pathway
sgh04110  Cell cycle
sgh04144  Endocytosis
sgh04218  Cellular senescence
sgh04350  TGF-beta signaling pathway
sgh04371  Apelin signaling pathway
sgh04520  Adherens junction
sgh04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    107553101
   04371 Apelin signaling pathway
    107553101
   04068 FoxO signaling pathway
    107553101
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107553101
  09143 Cell growth and death
   04110 Cell cycle
    107553101
   04218 Cellular senescence
    107553101
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    107553101
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107553101
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MH2 MH1 IRF-3
Motif
Other DBs
NCBI-GeneID: 107553101
NCBI-ProteinID: XP_016090709
LinkDB All DBs
Position
Unknown
AA seq 425 aa AA seqDB search
MSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNIN
TKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLQSHHELRAIELCEFAFHMKKDEVC
VNPYHYQRVETPVLPPVLVPRHTEIPSEFPPLDDYSHSIPENTIFPAGIEPQSNYIPETP
PPGYISEDGETSDHQMNRSMDTGSPNLSPNPVSPAHNNLDLQPVTYCEPAFWCSISYYEL
NQRVGETFHASQPSLTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIG
GEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGF
EAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIR
CSSVS
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgtcaattttaccgttcactccgccgatcgtgaagaggttgctgggctggaagaaagga
gagcagaacggacaggaggagaaatggtgcgaaaaagccgtcaagagtctggtgaagaag
ctgaagaagacgggacaactggacgagctcgagaaagccatcacaactcagaatatcaac
accaagtgtatcaccataccacgatcactagatggtcggttgcaagtatctcacagaaaa
ggactccctcatgtgatctactgtcgtctttggcgctggcctgacctgcagtctcatcat
gagctcagagccattgaactctgtgagtttgcctttcacatgaaaaaggacgaggtctgc
gtcaatccctaccactaccagcgggtcgagacaccagttcttcctccagtgctggtgcct
cgtcacactgaaatccctagtgagtttcctcctctggatgactacagtcactccatccca
gaaaacaccattttccccgctggcatcgaaccccagagcaactacataccagaaacaccc
cctccaggctacatcagtgaggatggagagacaagcgatcatcagatgaaccgcagtatg
gacacagggtctccaaatctgtcaccgaaccctgtttctcctgcccataacaatttagat
ctacagccggtgacatactgtgaaccagcgttctggtgctctatctcctactatgagctg
aaccaaagagtcggtgaaactttccatgcctcccagccctctttaacagtagacggcttc
acagacccgtccaactctgaacgcttctgcctgggcctgctgtccaacgtgaatcgcaat
gctgctgtggagctcacgcgcagacacattggccggggtgtgcgtttgtactacattggt
ggtgaagtgtttgcagagtgcctaagtgacagcgccatttttgttcagagtcccaactgt
aaccaacgttacggctggcaccctgccactgtttgcaagatcccacctggctgtaatctg
aagatctttaataaccaggagtttgcagctctgttggcccagtctgtgaatcagggcttt
gaggccgtgtaccagctcacccgcatgtgcaccattcgcatgagcttcgtgaagggctgg
ggagccgagtacaggcggcagacagtgactagcaccccctgctggatagaactgcacctg
aacggtcctcttcagtggctggacaaagtgctcactcagatgggctccccctccattcgc
tgctccagtgtgtcatag

DBGET integrated database retrieval system