KEGG   Sinocyclocheilus grahami: 107553388Help
Entry
107553388         CDS       T04918                                 

Definition
(RefSeq) amiloride-sensitive amine oxidase [copper-containing]-like
  KO
K11182  diamine oxidase [EC:1.4.3.22]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh00330  Arginine and proline metabolism
sgh00340  Histidine metabolism
sgh00380  Tryptophan metabolism
sgh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    107553388
   00340 Histidine metabolism
    107553388
   00380 Tryptophan metabolism
    107553388
Enzymes [BR:sgh01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.22  diamine oxidase
     107553388
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cu_amine_oxid Cu_amine_oxidN3 Cu_amine_oxidN2 DUF1965
Motif
Other DBs
NCBI-GeneID: 107553388
NCBI-ProteinID: XP_016091071
LinkDB All DBs
Position
Unknown
AA seq 742 aa AA seqDB search
MWFSWMLLLASLATSTASSRSREWALHGAAMFADLTPQEMNAVRDYLYSCSELGLTSARD
KSLKKNSILLMELHVPRKHEALRALDRGQARPSRQARVVVQFGNEAGPNVTEYIVGPLPF
PRSYQVKTFKGDRPIRFESRPISTVEYEHLSGVLEKVGAKANKILQESTGFTYGNCTNRC
LTFSDIAPRGLAPGERRTWIMLQKFVEGYFIHPVGFEVLVNHKDLDHEKWMVEKVWYNGQ
YFDSVEELVEKYEKGTIDKLKLPEHDEEDLFSTFIPRGHMNTPTNIHGAKLVEPQGRRFQ
VDGNFVEYAGWSFAYRVRSSAGLQIFDLRFNGERIAYEIALQEAIAFYSGDSPAAMQTKY
IDAGWAMGTSDYELAPGIDCPEIAHFVDLYHYYDTDKPVRYRNALCIFEMTTALPLRRHF
NSNFQGGYNFYGGLENHVLVIRTTSTVYNYDYIWDFVFYQNGVMESRVSATGYIHATFFT
ENGLNYGTRVYNYVLGNLHTHLIHYKVDLDIAGRDNSFETIDLKYVNFTNPWSPGHSIVQ
SKLHRTQHETERSAAFRFGKKFPKYLHFYNPKQNNKWGHKKGYRIQYNSHANSVLPRGWR
EENGITWSRYPLAVTRHKDNEATSSSIYTQHDPWEPVVSFEEFIRNNENIVNQDLVAWVT
VGFLHIPHSEDIPNTATPGNAVGFFLRPFNFFDEDPSLASRSTVIVRPDEKGQPKVQRWT
PEVVGHCVSDKPFFYNGTYAGV
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgtggttctcctggatgctgctcctggcttctctagctacatccaccgcttcgtcaaga
agtcgagagtgggctcttcacggagctgcaatgtttgctgatctcactccccaagagatg
aacgccgtgagagactacctctactcctgcagcgagctgggcctcacctcggcacgagac
aagtccctcaagaagaacagcatcctccttatggagctgcacgttcctcgcaagcacgag
gcgctccgtgcgctggacagaggacaggcaagaccttctcggcaggcacgtgtggtagtg
cagttcggcaacgaggcggggccaaatgttacggagtacatcgtcggacccctacctttc
ccgaggtcttaccaggtgaagacgtttaagggcgaccgtccaatccgttttgagtccagg
ccgatctccactgtggagtacgagcatctcagtggggttctggagaaagtaggagctaaa
gcaaacaagattcttcaagagagcactgggtttacttacggcaactgcactaatcgttgc
ttgaccttctcagacatcgctcctcgtgggttggcaccaggagagaggaggacgtggatc
atgctgcagaagtttgtggagggctacttcatccacccggtgggcttcgaggtcctcgtt
aaccacaaagatttggatcatgaaaagtggatggtggagaaggtgtggtacaacgggcag
tatttcgatagcgtggaggagcttgtggagaagtacgagaaggggacgatcgataaactc
aagctgccggagcatgacgaggaggatcttttttcaaccttcattcctcgtggacacatg
aatacaccaacgaacattcatggtgcaaagcttgtcgaaccccaaggccggagattccag
gtggatgggaattttgtggaatatgccggatggtccttcgcatatcgggttcgctcttcg
gccgggttgcagatctttgaccttcgcttcaacggggagagaattgcttatgaaatcgca
ctgcaggaggccattgccttctactccggagattctccggctgccatgcagaccaaatac
attgatgccggatgggcgatgggcacttcggattatgagttggcacctgggatcgactgt
ccagaaattgctcattttgtggacctttatcattactatgacacagacaaacctgtgcga
tacagaaacgcactttgcatttttgaaatgaccacagcgcttcctctgaggagacacttc
aatagcaacttccaaggaggctacaatttctatggaggcttggaaaaccatgttctggtg
atcagaactacatctacggtgtacaactatgactacatctgggactttgtcttctaccag
aatggcgtaatggagtctagagtgagtgcgactgggtacatccatgcaacgttcttcacg
gaaaatggactgaactatggaaccagggtttacaactatgttcttggtaacttgcacacc
catctaattcattacaaagtggaccttgacattgcagggagggacaacagctttgaaacc
attgatctgaaatatgttaactttaccaacccctggagcccaggacactccattgtgcaa
tcaaaactgcataggactcagcatgaaactgaacgtagtgctgccttccgatttggcaag
aagtttcccaaatacttgcacttctacaatcccaaacaaaacaacaagtggggacataag
aagggctatcggatccagtataactcgcatgctaacagtgttttgccccggggctggagg
gaggaaaatggtattacgtggtcaagatacccgttggcagtaaccagacacaaagacaat
gaggccaccagctctagcatctacactcagcatgacccttgggagcctgttgtttccttt
gaggaattcattcgcaacaatgaaaacatagttaaccaggatttggttgcctgggtgacg
gtgggattcttacacattcctcattctgaagacattcccaacacagcgactccaggaaac
gcagtgggattctttctgcgtcccttcaactttttcgacgaggacccctcgctcgcgtcc
cgcagcacagtcattgtgcgacccgatgagaagggccagccgaaggttcagagatggact
ccagaggtcgtaggtcactgtgtctcagacaagcctttcttctacaatggcacgtatgct
ggcgtctag

DBGET integrated database retrieval system