KEGG   Sinocyclocheilus grahami: 107553508Help
Entry
107553508         CDS       T04918                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN-like isoform X1
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh00562  Inositol phosphate metabolism
sgh01100  Metabolic pathways
sgh04068  FoxO signaling pathway
sgh04070  Phosphatidylinositol signaling system
sgh04115  p53 signaling pathway
sgh04140  Autophagy - animal
sgh04150  mTOR signaling pathway
sgh04218  Cellular senescence
sgh04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107553508
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    107553508
   04070 Phosphatidylinositol signaling system
    107553508
   04150 mTOR signaling pathway
    107553508
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107553508
  09143 Cell growth and death
   04115 p53 signaling pathway
    107553508
   04218 Cellular senescence
    107553508
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107553508
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sgh01009]
    107553508
Enzymes [BR:sgh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     107553508
    3.1.3.48  protein-tyrosine-phosphatase
     107553508
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     107553508
Protein phosphatases and associated proteins [BR:sgh01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    107553508
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase PTPlike_phytase Y_phosphatase3
Motif
Other DBs
NCBI-GeneID: 107553508
NCBI-ProteinID: XP_016091246
LinkDB All DBs
Position
Unknown
AA seq 461 aa AA seqDB search
MAMTAKIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLD
SKHKNHYKIYNLCAERHYDASKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDENH
VAAIHCKAGKGRTGVMICAYLLHRRKFLEAQEALDFYGEVRTRDKKGVTIPSQCRYVYYY
SYLLKNKLEYKPIALLFHKMVFQTLPMFSGGTCRDSTVKNRSEVNPQGFKKGNWHWDPQF
VVYQLKVKIHTSNPAHTRREEKHMIFEFPQPLPVCGDIKVEFFHKQSKMMKKDKMFHFWI
NTFFIPGPEEAGEKVENGSVVNDVDSLSSQCQSFLAEREREKERGIEVGGFEREKGAERG
GERAGVSDGDKDYLILTLTKNDLDKANKDKANRYFSPNFKVKLYFTKTVEEPSNSEASTS
TSVTPDVSDNEPDHYRYSDTTDSDPENEPFDEEQHAQITKV
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggcaatgactgcaaaaattaaagaaatagtcagtcggaataagaggcgctaccaagaa
gatgggttcgatttggacttaacgtacatctacccaaatatcattgccatgggattccct
gcagaacggttggagggagtttacagaaacaatatagatgatgtggttcgattcctagat
tcgaagcacaaaaatcattataaaatttataatctatgtgctgaacgacactacgatgca
tccaaattcaattgtagggtggctcaatatcccttcgaggaccataacccgccacagttg
gaattaataaagcccttctgcgaggatcttgaccagtggctgtctgaagacgagaaccac
gtggcggccatccactgcaaggcaggcaaaggtcgcacgggggtcatgatatgcgcctac
ctgttgcatcgcaggaagttcttagaggcacaagaggcactggacttttatggggaagtc
aggaccagggataaaaagggggtcaccattcccagccagtgcaggtatgtgtattactac
agctacctgctgaagaacaagctggaatataaacccattgctctcctcttccataaaatg
gttttccagactctgcccatgttcagtgggggcacctgcagggacagtactgttaaaaac
aggagtgaggtgaatccccagggcttcaagaaaggcaactggcactgggaccctcagttc
gtcgtgtatcagttgaaggtaaagatccacacgtcaaacccagcccacacacggagggaa
gaaaagcacatgatctttgagttccctcagcctcttccggtttgtggcgacatcaaagtg
gaattcttccacaaacagagcaagatgatgaagaaggataaaatgttccatttctggata
aacacgttcttcatcccgggtcccgaggaagctggggagaaagtagagaatgggtcggtg
gtcaacgatgtggacagcctctcctctcagtgccagagctttctagcagagagggagaga
gaaaaggagcgagggatcgaagtgggaggatttgaaagagaaaagggtgcagaaagggga
ggagagcgagcaggagtatcggatggagataaagactacttgattctgaccttaacaaag
aacgacttggataaggccaataaggacaaagctaaccgatatttctcacccaacttcaag
gtgaagttgtacttcaccaagaccgtggaggagccctcaaactcagaagcgagcacgtca
acttctgtcactccggatgtgagtgataatgaacctgatcactaccgctattcagacacc
actgattccgacccagaaaatgaaccttttgatgaggaacaacacgcacagattacaaaa
gtctga

DBGET integrated database retrieval system