Sinocyclocheilus grahami: 107553525 Help Entry 107553525         CDS       T04918                                  Definition (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism sgh  Sinocyclocheilus grahami Pathway sgh04060   Cytokine-cytokine receptor interaction sgh04218   Cellular senescence sgh04620   Toll-like receptor signaling pathway sgh04621   NOD-like receptor signaling pathway sgh04622   RIG-I-like receptor signaling pathway sgh05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sgh00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     107553525  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     107553525  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     107553525    04621 NOD-like receptor signaling pathway     107553525    04622 RIG-I-like receptor signaling pathway     107553525  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     107553525  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:sgh04052]     107553525    00536 Glycosaminoglycan binding proteins [BR:sgh00536]     107553525 Cytokines and growth factors [BR:sgh04052]  Cytokines   Chemokines    107553525 Glycosaminoglycan binding proteins [BR:sgh00536]  Heparan sulfate / Heparin   Chemokines    107553525 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  107553525 NCBI-ProteinID:  XP_016091273 UniProt:  A0A672RBY8 LinkDB All DBs Position Unknown AA seq 98 aa AA seqDB search MKFSASAFMLLICTAALLSTTEGRPKPINLRCECIKTYAEPAIPTEKIQSLRVIPAGPQC KNEEIIATMKKGKMCLSPAKDWVISLKEKINKKVKSQQ NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgaagttcagcgcatctgccttcatgcttctgatctgcacagctgcactgctgtccaca acagagggtagacctaaacccattaatctacgctgtgagtgcattaaaacatatgcagag ccagcaatccctactgaaaaaatacagtcattgagggtgattcctgctggaccacaatgc aaaaatgaggagatcattgccacaatgaagaaaggaaagatgtgtctcagtcctgcaaaa gactgggtgatttctctcaaagaaaaaatcaacaagaaggtcaagagccaacagtga

Sinocyclocheilus grahami: 107553526 Help Entry 107553526         CDS       T04918                                  Definition (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism sgh  Sinocyclocheilus grahami Pathway sgh04060   Cytokine-cytokine receptor interaction sgh04218   Cellular senescence sgh04620   Toll-like receptor signaling pathway sgh04621   NOD-like receptor signaling pathway sgh04622   RIG-I-like receptor signaling pathway sgh05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sgh00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     107553526  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     107553526  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     107553526    04621 NOD-like receptor signaling pathway     107553526    04622 RIG-I-like receptor signaling pathway     107553526  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     107553526  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:sgh04052]     107553526    00536 Glycosaminoglycan binding proteins [BR:sgh00536]     107553526 Cytokines and growth factors [BR:sgh04052]  Cytokines   Chemokines    107553526 Glycosaminoglycan binding proteins [BR:sgh00536]  Heparan sulfate / Heparin   Chemokines    107553526 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Gp_UL130 Motif Other DBs NCBI-GeneID:  107553526 NCBI-ProteinID:  XP_016091274 LinkDB All DBs Position Unknown AA seq 85 aa AA seqDB search MKFTAAAFVFLTCMTLLFTTEARLQLRCPCIKMYSGKPINPKLIQKVQMIPAGAQCKNVA IIATLKNGQTCLNPRDEWVKKIIKG NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgaaattcaccgcagcagcctttgtttttctgacatgcatgacactgctgttcacaaca gaagccagactacagctacgctgcccgtgtattaaaatgtattcgggaaaaccaattaac cctaaactaatacagaaagtacaaatgattcctgccggagcacagtgcaaaaacgtggcg atcattgccactctgaaaaatgggcagacgtgcctcaatcccagagatgaatgggtgaaa aagatcatcaaaggataa

Sinocyclocheilus grahami: 107553781 Help Entry 107553781         CDS       T04918                                  Definition (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism sgh  Sinocyclocheilus grahami Pathway sgh04060   Cytokine-cytokine receptor interaction sgh04218   Cellular senescence sgh04620   Toll-like receptor signaling pathway sgh04621   NOD-like receptor signaling pathway sgh04622   RIG-I-like receptor signaling pathway sgh05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sgh00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     107553781  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     107553781  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     107553781    04621 NOD-like receptor signaling pathway     107553781    04622 RIG-I-like receptor signaling pathway     107553781  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     107553781  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:sgh04052]     107553781    00536 Glycosaminoglycan binding proteins [BR:sgh00536]     107553781 Cytokines and growth factors [BR:sgh04052]  Cytokines   Chemokines    107553781 Glycosaminoglycan binding proteins [BR:sgh00536]  Heparan sulfate / Heparin   Chemokines    107553781 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  107553781 NCBI-ProteinID:  XP_016091573 UniProt:  A0A672LPR9 LinkDB All DBs Position Unknown AA seq 99 aa AA seqDB search MNAFLMLTVIGVSIVLSDAVQPLGAGYNSRCVCLKLESRIIPQENLRRVEILPRGPHCKT TEVIAGLSSGERICLNPRTPWVKKLILFIERKERVTKKM NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgaacgctttcctgatgttaaccgttattggagtcagcatcgttctgtctgatgccgtg cagcctctgggcgcgggttacaacagccgctgtgtgtgtctgaaactggagtcgcggatc atcccacaggagaacctgcggcgcgtggagatcctgccgagaggcccgcactgcaagact actgaggttattgctggtttatcgagtggagagaggatctgtctgaaccccaggacacca tgggttaaaaaactcattctcttcattgagagaaaggagcgagtgaccaagaaaatgtaa

Sinocyclocheilus grahami: 107553783 Help Entry 107553783         CDS       T04918                                  Definition (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism sgh  Sinocyclocheilus grahami Pathway sgh04060   Cytokine-cytokine receptor interaction sgh04218   Cellular senescence sgh04620   Toll-like receptor signaling pathway sgh04621   NOD-like receptor signaling pathway sgh04622   RIG-I-like receptor signaling pathway sgh05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sgh00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     107553783  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     107553783  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     107553783    04621 NOD-like receptor signaling pathway     107553783    04622 RIG-I-like receptor signaling pathway     107553783  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     107553783  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:sgh04052]     107553783    00536 Glycosaminoglycan binding proteins [BR:sgh00536]     107553783 Cytokines and growth factors [BR:sgh04052]  Cytokines   Chemokines    107553783 Glycosaminoglycan binding proteins [BR:sgh00536]  Heparan sulfate / Heparin   Chemokines    107553783 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Gp_UL130 Motif Other DBs NCBI-GeneID:  107553783 NCBI-ProteinID:  XP_016091574 LinkDB All DBs Position Unknown AA seq 92 aa AA seqDB search MRKFTTSAFVFLTCMTLLSTTEVIAARLPAQQLRCQCVKTYSGKPINPKLIQKVQMIPAG AQCKNMEIIATLKNGQTCLNPRDEWVKNIIKA NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaggaagttcaccacatcagcctttgtttttctgacctgcatgacgctgctgtccaca acagaagtcattgctgccagactgccggcccaacagctacgctgccagtgcgttaaaacg tattcgggaaaaccaattaaccctaaactaatacagaaagtacaaatgattcctgctgga gcacaatgcaaaaacatggagatcattgccactctgaaaaatggacagacgtgcctcaat cccagagatgaatgggtgaaaaatatcatcaaagcatga

Sinocyclocheilus grahami: 107553784 Help Entry 107553784         CDS       T04918                                  Definition (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism sgh  Sinocyclocheilus grahami Pathway sgh04060   Cytokine-cytokine receptor interaction sgh04218   Cellular senescence sgh04620   Toll-like receptor signaling pathway sgh04621   NOD-like receptor signaling pathway sgh04622   RIG-I-like receptor signaling pathway sgh05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sgh00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     107553784  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     107553784  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     107553784    04621 NOD-like receptor signaling pathway     107553784    04622 RIG-I-like receptor signaling pathway     107553784  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     107553784  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:sgh04052]     107553784    00536 Glycosaminoglycan binding proteins [BR:sgh00536]     107553784 Cytokines and growth factors [BR:sgh04052]  Cytokines   Chemokines    107553784 Glycosaminoglycan binding proteins [BR:sgh00536]  Heparan sulfate / Heparin   Chemokines    107553784 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  107553784 NCBI-ProteinID:  XP_016091575 UniProt:  A0A672LTD4 LinkDB All DBs Position Unknown AA seq 99 aa AA seqDB search MKLTVSALVLLICTAALLSTTEGRPKRLQLRCSCPQMHSESAIPAVKILSLRVIPAGPHC KNEEIIATMKKGPMCLDPTKDWVISLKEEINKRNVTSQQ NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgaaactcacagtatcggctctcgtgcttcttatctgcacagctgcactgctgtccaca acagagggtagacctaaacgcctacagctacgctgcagctgccctcaaatgcattcagag tcagcaattcctgctgtaaaaatactctcattgagggttattcctgctggaccacattgc aaaaatgaagagatcattgccacaatgaagaaaggaccgatgtgtcttgatcctactaaa gactgggtgatttctctcaaagaagaaatcaacaagaggaacgtcacaagccaacaatga

Sinocyclocheilus grahami: 107562973 Help Entry 107562973         CDS       T04918                                  Definition (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism sgh  Sinocyclocheilus grahami Pathway sgh04060   Cytokine-cytokine receptor interaction sgh04218   Cellular senescence sgh04620   Toll-like receptor signaling pathway sgh04621   NOD-like receptor signaling pathway sgh04622   RIG-I-like receptor signaling pathway sgh05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sgh00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     107562973  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     107562973  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     107562973    04621 NOD-like receptor signaling pathway     107562973    04622 RIG-I-like receptor signaling pathway     107562973  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     107562973  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:sgh04052]     107562973    00536 Glycosaminoglycan binding proteins [BR:sgh00536]     107562973 Cytokines and growth factors [BR:sgh04052]  Cytokines   Chemokines    107562973 Glycosaminoglycan binding proteins [BR:sgh00536]  Heparan sulfate / Heparin   Chemokines    107562973 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  107562973 NCBI-ProteinID:  XP_016103219 UniProt:  A0A672LQP0 LinkDB All DBs Position Unknown AA seq 98 aa AA seqDB search MHCKIFSVSVIVFLGFLTIVEGMSLRGLGVDPRCRCIETESRRIGKHIESVELFPPSPQC KDTEIIATLKGSRKEICLDPTAPWVKKVIEKIIANKAP NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgcactgcaaaatcttttccgtctctgttattgtttttctgggattcctgaccattgtt gaaggaatgagtcttagaggtctgggtgtagatccacgctgtcgctgcattgaaacagag agtcgacgcattggaaaacacatagagagtgtggagctcttccctccaagcccacaatgt aaagacacagagatcattgccaccctgaagggatccagaaaagagatctgtctggaccct actgcaccctgggttaagaaggtcattgagaagatcattgccaacaaagcaccatga

Sinocyclocheilus grahami: 107565350 Help Entry 107565350         CDS       T04918                                  Definition (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism sgh  Sinocyclocheilus grahami Pathway sgh04060   Cytokine-cytokine receptor interaction sgh04218   Cellular senescence sgh04620   Toll-like receptor signaling pathway sgh04621   NOD-like receptor signaling pathway sgh04622   RIG-I-like receptor signaling pathway sgh05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sgh00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     107565350  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     107565350  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     107565350    04621 NOD-like receptor signaling pathway     107565350    04622 RIG-I-like receptor signaling pathway     107565350  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     107565350  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:sgh04052]     107565350    00536 Glycosaminoglycan binding proteins [BR:sgh00536]     107565350 Cytokines and growth factors [BR:sgh04052]  Cytokines   Chemokines    107565350 Glycosaminoglycan binding proteins [BR:sgh00536]  Heparan sulfate / Heparin   Chemokines    107565350 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  107565350 NCBI-ProteinID:  XP_016106052 LinkDB All DBs Position Unknown AA seq 98 aa AA seqDB search MHCKIFLVSVIVSLGFLTIGEGMSLRGLGVDPRCRCIETESRRIGKQIESVELFPPSSHC KYTEIVATLKISGKEICLDPTAPWVKKVIEKIIANKAS NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgcactgcaaaatctttttagtctctgttatcgtttcccttggattcctgaccattggt gaaggaatgagtcttagaggtctgggtgtagatccacgctgtcgctgcattgaaactgag agtcgacgcattggaaaacagatagagagtgtggagctcttccctccaagctcacactgt aaatacacagagatcgttgccaccctgaagatatctgggaaagagatctgtctggaccct actgcaccctgggttaagaaggtcattgagaagatcattgccaacaaagcctcatga

DBGET integrated database retrieval system