KEGG   Sinocyclocheilus grahami: 107553525
Entry
107553525         CDS       T04918                                 

Definition
(RefSeq) interleukin-8-like
  KO
K10030  interleukin 8
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04060  Cytokine-cytokine receptor interaction
sgh04218  Cellular senescence
sgh04620  Toll-like receptor signaling pathway
sgh04621  NOD-like receptor signaling pathway
sgh04622  RIG-I-like receptor signaling pathway
sgh05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107553525
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    107553525
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107553525
   04621 NOD-like receptor signaling pathway
    107553525
   04622 RIG-I-like receptor signaling pathway
    107553525
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107553525
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sgh04052]
    107553525
   00536 Glycosaminoglycan binding proteins [BR:sgh00536]
    107553525
Cytokines and growth factors [BR:sgh04052]
 Cytokines
  Chemokines
   107553525
Glycosaminoglycan binding proteins [BR:sgh00536]
 Heparan sulfate / Heparin
  Chemokines
   107553525
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 107553525
NCBI-ProteinID: XP_016091273
UniProt: A0A672RBY8
LinkDB
Position
Unknown
AA seq 98 aa
MKFSASAFMLLICTAALLSTTEGRPKPINLRCECIKTYAEPAIPTEKIQSLRVIPAGPQC
KNEEIIATMKKGKMCLSPAKDWVISLKEKINKKVKSQQ
NT seq 297 nt   +upstreamnt  +downstreamnt
atgaagttcagcgcatctgccttcatgcttctgatctgcacagctgcactgctgtccaca
acagagggtagacctaaacccattaatctacgctgtgagtgcattaaaacatatgcagag
ccagcaatccctactgaaaaaatacagtcattgagggtgattcctgctggaccacaatgc
aaaaatgaggagatcattgccacaatgaagaaaggaaagatgtgtctcagtcctgcaaaa
gactgggtgatttctctcaaagaaaaaatcaacaagaaggtcaagagccaacagtga

KEGG   Sinocyclocheilus grahami: 107553526
Entry
107553526         CDS       T04918                                 

Definition
(RefSeq) interleukin-8-like
  KO
K10030  interleukin 8
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04060  Cytokine-cytokine receptor interaction
sgh04218  Cellular senescence
sgh04620  Toll-like receptor signaling pathway
sgh04621  NOD-like receptor signaling pathway
sgh04622  RIG-I-like receptor signaling pathway
sgh05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107553526
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    107553526
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107553526
   04621 NOD-like receptor signaling pathway
    107553526
   04622 RIG-I-like receptor signaling pathway
    107553526
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107553526
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sgh04052]
    107553526
   00536 Glycosaminoglycan binding proteins [BR:sgh00536]
    107553526
Cytokines and growth factors [BR:sgh04052]
 Cytokines
  Chemokines
   107553526
Glycosaminoglycan binding proteins [BR:sgh00536]
 Heparan sulfate / Heparin
  Chemokines
   107553526
SSDB
Motif
Pfam: IL8 Gp_UL130
Other DBs
NCBI-GeneID: 107553526
NCBI-ProteinID: XP_016091274
LinkDB
Position
Unknown
AA seq 85 aa
MKFTAAAFVFLTCMTLLFTTEARLQLRCPCIKMYSGKPINPKLIQKVQMIPAGAQCKNVA
IIATLKNGQTCLNPRDEWVKKIIKG
NT seq 258 nt   +upstreamnt  +downstreamnt
atgaaattcaccgcagcagcctttgtttttctgacatgcatgacactgctgttcacaaca
gaagccagactacagctacgctgcccgtgtattaaaatgtattcgggaaaaccaattaac
cctaaactaatacagaaagtacaaatgattcctgccggagcacagtgcaaaaacgtggcg
atcattgccactctgaaaaatgggcagacgtgcctcaatcccagagatgaatgggtgaaa
aagatcatcaaaggataa

KEGG   Sinocyclocheilus grahami: 107553781
Entry
107553781         CDS       T04918                                 

Definition
(RefSeq) interleukin-8-like
  KO
K10030  interleukin 8
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04060  Cytokine-cytokine receptor interaction
sgh04218  Cellular senescence
sgh04620  Toll-like receptor signaling pathway
sgh04621  NOD-like receptor signaling pathway
sgh04622  RIG-I-like receptor signaling pathway
sgh05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107553781
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    107553781
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107553781
   04621 NOD-like receptor signaling pathway
    107553781
   04622 RIG-I-like receptor signaling pathway
    107553781
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107553781
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sgh04052]
    107553781
   00536 Glycosaminoglycan binding proteins [BR:sgh00536]
    107553781
Cytokines and growth factors [BR:sgh04052]
 Cytokines
  Chemokines
   107553781
Glycosaminoglycan binding proteins [BR:sgh00536]
 Heparan sulfate / Heparin
  Chemokines
   107553781
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 107553781
NCBI-ProteinID: XP_016091573
UniProt: A0A672LPR9
LinkDB
Position
Unknown
AA seq 99 aa
MNAFLMLTVIGVSIVLSDAVQPLGAGYNSRCVCLKLESRIIPQENLRRVEILPRGPHCKT
TEVIAGLSSGERICLNPRTPWVKKLILFIERKERVTKKM
NT seq 300 nt   +upstreamnt  +downstreamnt
atgaacgctttcctgatgttaaccgttattggagtcagcatcgttctgtctgatgccgtg
cagcctctgggcgcgggttacaacagccgctgtgtgtgtctgaaactggagtcgcggatc
atcccacaggagaacctgcggcgcgtggagatcctgccgagaggcccgcactgcaagact
actgaggttattgctggtttatcgagtggagagaggatctgtctgaaccccaggacacca
tgggttaaaaaactcattctcttcattgagagaaaggagcgagtgaccaagaaaatgtaa

KEGG   Sinocyclocheilus grahami: 107553783
Entry
107553783         CDS       T04918                                 

Definition
(RefSeq) interleukin-8-like
  KO
K10030  interleukin 8
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04060  Cytokine-cytokine receptor interaction
sgh04218  Cellular senescence
sgh04620  Toll-like receptor signaling pathway
sgh04621  NOD-like receptor signaling pathway
sgh04622  RIG-I-like receptor signaling pathway
sgh05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107553783
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    107553783
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107553783
   04621 NOD-like receptor signaling pathway
    107553783
   04622 RIG-I-like receptor signaling pathway
    107553783
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107553783
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sgh04052]
    107553783
   00536 Glycosaminoglycan binding proteins [BR:sgh00536]
    107553783
Cytokines and growth factors [BR:sgh04052]
 Cytokines
  Chemokines
   107553783
Glycosaminoglycan binding proteins [BR:sgh00536]
 Heparan sulfate / Heparin
  Chemokines
   107553783
SSDB
Motif
Pfam: IL8 Gp_UL130
Other DBs
NCBI-GeneID: 107553783
NCBI-ProteinID: XP_016091574
LinkDB
Position
Unknown
AA seq 92 aa
MRKFTTSAFVFLTCMTLLSTTEVIAARLPAQQLRCQCVKTYSGKPINPKLIQKVQMIPAG
AQCKNMEIIATLKNGQTCLNPRDEWVKNIIKA
NT seq 279 nt   +upstreamnt  +downstreamnt
atgaggaagttcaccacatcagcctttgtttttctgacctgcatgacgctgctgtccaca
acagaagtcattgctgccagactgccggcccaacagctacgctgccagtgcgttaaaacg
tattcgggaaaaccaattaaccctaaactaatacagaaagtacaaatgattcctgctgga
gcacaatgcaaaaacatggagatcattgccactctgaaaaatggacagacgtgcctcaat
cccagagatgaatgggtgaaaaatatcatcaaagcatga

KEGG   Sinocyclocheilus grahami: 107553784
Entry
107553784         CDS       T04918                                 

Definition
(RefSeq) interleukin-8-like
  KO
K10030  interleukin 8
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04060  Cytokine-cytokine receptor interaction
sgh04218  Cellular senescence
sgh04620  Toll-like receptor signaling pathway
sgh04621  NOD-like receptor signaling pathway
sgh04622  RIG-I-like receptor signaling pathway
sgh05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107553784
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    107553784
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107553784
   04621 NOD-like receptor signaling pathway
    107553784
   04622 RIG-I-like receptor signaling pathway
    107553784
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107553784
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sgh04052]
    107553784
   00536 Glycosaminoglycan binding proteins [BR:sgh00536]
    107553784
Cytokines and growth factors [BR:sgh04052]
 Cytokines
  Chemokines
   107553784
Glycosaminoglycan binding proteins [BR:sgh00536]
 Heparan sulfate / Heparin
  Chemokines
   107553784
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 107553784
NCBI-ProteinID: XP_016091575
UniProt: A0A672LTD4
LinkDB
Position
Unknown
AA seq 99 aa
MKLTVSALVLLICTAALLSTTEGRPKRLQLRCSCPQMHSESAIPAVKILSLRVIPAGPHC
KNEEIIATMKKGPMCLDPTKDWVISLKEEINKRNVTSQQ
NT seq 300 nt   +upstreamnt  +downstreamnt
atgaaactcacagtatcggctctcgtgcttcttatctgcacagctgcactgctgtccaca
acagagggtagacctaaacgcctacagctacgctgcagctgccctcaaatgcattcagag
tcagcaattcctgctgtaaaaatactctcattgagggttattcctgctggaccacattgc
aaaaatgaagagatcattgccacaatgaagaaaggaccgatgtgtcttgatcctactaaa
gactgggtgatttctctcaaagaagaaatcaacaagaggaacgtcacaagccaacaatga

KEGG   Sinocyclocheilus grahami: 107562973
Entry
107562973         CDS       T04918                                 

Definition
(RefSeq) interleukin-8-like
  KO
K10030  interleukin 8
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04060  Cytokine-cytokine receptor interaction
sgh04218  Cellular senescence
sgh04620  Toll-like receptor signaling pathway
sgh04621  NOD-like receptor signaling pathway
sgh04622  RIG-I-like receptor signaling pathway
sgh05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107562973
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    107562973
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107562973
   04621 NOD-like receptor signaling pathway
    107562973
   04622 RIG-I-like receptor signaling pathway
    107562973
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107562973
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sgh04052]
    107562973
   00536 Glycosaminoglycan binding proteins [BR:sgh00536]
    107562973
Cytokines and growth factors [BR:sgh04052]
 Cytokines
  Chemokines
   107562973
Glycosaminoglycan binding proteins [BR:sgh00536]
 Heparan sulfate / Heparin
  Chemokines
   107562973
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 107562973
NCBI-ProteinID: XP_016103219
UniProt: A0A672LQP0
LinkDB
Position
Unknown
AA seq 98 aa
MHCKIFSVSVIVFLGFLTIVEGMSLRGLGVDPRCRCIETESRRIGKHIESVELFPPSPQC
KDTEIIATLKGSRKEICLDPTAPWVKKVIEKIIANKAP
NT seq 297 nt   +upstreamnt  +downstreamnt
atgcactgcaaaatcttttccgtctctgttattgtttttctgggattcctgaccattgtt
gaaggaatgagtcttagaggtctgggtgtagatccacgctgtcgctgcattgaaacagag
agtcgacgcattggaaaacacatagagagtgtggagctcttccctccaagcccacaatgt
aaagacacagagatcattgccaccctgaagggatccagaaaagagatctgtctggaccct
actgcaccctgggttaagaaggtcattgagaagatcattgccaacaaagcaccatga

KEGG   Sinocyclocheilus grahami: 107565350
Entry
107565350         CDS       T04918                                 

Definition
(RefSeq) interleukin-8-like
  KO
K10030  interleukin 8
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04060  Cytokine-cytokine receptor interaction
sgh04218  Cellular senescence
sgh04620  Toll-like receptor signaling pathway
sgh04621  NOD-like receptor signaling pathway
sgh04622  RIG-I-like receptor signaling pathway
sgh05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107565350
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    107565350
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107565350
   04621 NOD-like receptor signaling pathway
    107565350
   04622 RIG-I-like receptor signaling pathway
    107565350
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107565350
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sgh04052]
    107565350
   00536 Glycosaminoglycan binding proteins [BR:sgh00536]
    107565350
Cytokines and growth factors [BR:sgh04052]
 Cytokines
  Chemokines
   107565350
Glycosaminoglycan binding proteins [BR:sgh00536]
 Heparan sulfate / Heparin
  Chemokines
   107565350
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 107565350
NCBI-ProteinID: XP_016106052
LinkDB
Position
Unknown
AA seq 98 aa
MHCKIFLVSVIVSLGFLTIGEGMSLRGLGVDPRCRCIETESRRIGKQIESVELFPPSSHC
KYTEIVATLKISGKEICLDPTAPWVKKVIEKIIANKAS
NT seq 297 nt   +upstreamnt  +downstreamnt
atgcactgcaaaatctttttagtctctgttatcgtttcccttggattcctgaccattggt
gaaggaatgagtcttagaggtctgggtgtagatccacgctgtcgctgcattgaaactgag
agtcgacgcattggaaaacagatagagagtgtggagctcttccctccaagctcacactgt
aaatacacagagatcgttgccaccctgaagatatctgggaaagagatctgtctggaccct
actgcaccctgggttaagaaggtcattgagaagatcattgccaacaaagcctcatga

DBGET integrated database retrieval system