KEGG   Sinocyclocheilus grahami: 107553584
Entry
107553584         CDS       T04918                                 

Definition
(RefSeq) nitric oxide synthase, inducible-like
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh00220  Arginine biosynthesis
sgh00330  Arginine and proline metabolism
sgh01100  Metabolic pathways
sgh04020  Calcium signaling pathway
sgh04146  Peroxisome
sgh04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    107553584
   00330 Arginine and proline metabolism
    107553584
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107553584
   04020 Calcium signaling pathway
    107553584
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    107553584
Enzymes [BR:sgh01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     107553584
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 NAD_binding_6
Other DBs
NCBI-GeneID: 107553584
NCBI-ProteinID: XP_016091338
LinkDB
Position
Unknown
AA seq 1083 aa
MGKQARTTTIVKDKPTVQTELKVERSVDRPVRCPFAVHLRNYTDGSTHQDMLHHRAVKNM
ACNSKTCEGSIMNPKTLIHGPSKMTPSSDDILTQASDFIDQYYKSFKIPNQTEHQARIDR
VTLEITLTGSYTLTTDELAFGAKHAWRNAPRCIGRIQWANLQLFDARQCKTAKDMFNALC
THLNYATNGGNLRSAITVFPKRTDGEHDFRVWNSQLIKYAGYQMEDGSVIGDPAGVEFTQ
VCIHLGWKPKYGRFDVLPLVLQANGEDPEVFDIPPELILEVPIEHPEYEWFKDLNLKWYA
IPAVASMLMEIGGLEFTACPFNGWYMGTEIGVRDFCDSQRYNVLERVGQLMGLETRKLSS
LWKDQALVAINVAVIHSYQKNKVTITDHHSASESFMQHLETEVRQRGGCPADWVWLVPPM
SGSLTPVYHQEMLNYILSPFFYYQADAWLTHKWKDEKKGLRRCKVSFKGLIRAVFFSQML
IKAVMAKRVRCTVLYATETGKSLTFAKKLNTMLNRAFDSRLVCMEDYDFSELETESLLMV
VTSTFGNGESPGNGVSFKKQLFNLQHLKNTVRYSVFGLGSRVYPQFCAFAHAVDDKLAEL
GAKRLTATGEGDELNGQDEAFSAWACTAFKDACEEFNIKKQLKAVEEQSDDWDPLRYRVQ
HDSCTLDRVTALSALHSKTVFPMTLKRRQKLQCAQSSRSTILVELKTDGNAEALNFAPGD
HVGIFPENSPELVDGILKHLPDAPPVNQSFHLESLSDSSHEEKRWLTDERIPACTLAHAL
TYFIDVTTPPSQSLLRKLSTVAGQEEDRKRLEALASDFQEYSTWKDFYRPTFLEVLEEFP
SLKVPATFLLSQLPLLKPRLYSVSSSLDRHPNELHLTVSVVEYHTQGGKGPLHFGTCSTW
LNTIKRGHTVPCFVHRSGGFHLPEDPSTPVILIGAGSGIAPFRSFWQQRIHDMKKTGLQV
SPMTLLFGCRDSESDHLYKVETLKLRLDGILGNVNTAYSRQPGKPKMYVQDVLREQLSEK
AVEVLHKNAGHLYVCGGMNMARDVAGTLQDILASKTGMAIAEAGEYLERMKVEKRYHEDI
FGA
NT seq 3252 nt   +upstreamnt  +downstreamnt
atgggaaaacaagcccgaaccacaaccattgtgaaagacaaacccactgtgcagactgag
ctgaaagtggaaaggtcagtcgatcggccagttcgatgtccatttgctgttcatttgcga
aactacacggatggctcgacccaccaagatatgctgcatcacagagcagttaagaatatg
gcctgcaattccaaaacttgcgaaggctccatcatgaatcccaaaactctgatacatggt
ccttccaaaatgacaccttcctcagatgacatcctcacccaggcatcggattttatcgat
cagtactacaaatcattcaaaatcccgaatcaaacggagcaccaggctcggattgacagg
gtcacactggagatcaccctgactggctcctacacactcactacagatgagctcgctttt
ggggccaaacatgcttggagaaacgcgccgaggtgcattggcaggatccagtgggccaat
ttacagcttttcgatgcgcgtcagtgcaagaccgccaaggacatgtttaatgccttgtgt
actcatcttaattatgccaccaatggaggaaacttgagatctgccatcactgtgttccct
aaaagaacagacggagagcatgatttccgtgtgtggaacagtcagcttataaagtacgca
ggctaccagatggaagatggtagtgtgattggagacccagcaggtgtggagtttacacag
gtgtgcattcacctgggatggaaaccaaagtatggtcgatttgatgtgcttccactggtc
ctgcaggcgaatggagaggaccctgaagtttttgatattcctccagaactgatcctggag
gtcccaatagagcacccagagtatgaatggttcaaagatctaaacctcaagtggtatgca
attcctgcagtggccagcatgctcatggaaattggtggtctggaattcacagcatgtcct
ttcaatggctggtacatgggcacagagatcggagtcagggacttctgtgacagccagcgc
tacaacgttttggagcgggtcggccagctaatgggcttagagacacgcaagctgtcttca
ttgtggaaagaccaagcacttgtggctatcaatgttgcagtgattcatagctaccagaaa
aataaggtcaccatcacggaccaccattcagcaagcgagtctttcatgcagcatttggag
acagaagttcgtcagcgtggaggctgtccagctgattgggtgtggttggtcccgcccatg
tctggctccctcacccccgtgtaccatcaggagatgctcaactacatcctttcccccttc
ttctattaccaggctgatgcatggctaacacacaagtggaaagatgagaagaaaggtctt
cggagatgtaaggtcagcttcaaaggactcataagagcagtgtttttttctcaaatgctc
atcaaagcagtcatggccaagagggtgcgctgcactgttctctatgccacagaaacaggg
aagtcactgacctttgccaaaaaactgaacaccatgctcaaccgtgccttcgactccagg
ctggtctgcatggaggattatgatttcagtgagcttgagacagagagtcttctgatggtg
gtcaccagtactttcggcaatggggaaagcccaggaaacggagtgagcttcaagaagcag
cttttcaacttgcaacacctgaaaaacactgtcaggtacagtgtgtttggccttggctca
cgtgtgtacccacaattctgtgcctttgcccatgctgtggatgacaagcttgctgagttg
ggggccaagcgtctgactgccacaggggagggagatgaacttaatgggcaggacgaggct
ttctctgcctgggcttgcactgcttttaaggatgcatgtgaggagtttaacattaaaaaa
cagctgaaagctgttgaggaacagtcggacgactgggacccactgagatacagagtgcag
catgacagttgcactctggaccgagttacagcactgtctgctcttcactctaaaactgtg
tttcctatgacgctgaaaagaaggcagaaactgcagtgcgctcagtcaagtcgttctact
atcctggttgagctgaagacagatggaaacgcagaggccttgaactttgcccctggagat
catgtggggatttttccagagaattctccagagctggtggatggtattttgaagcatctc
ccagatgcccctccagtaaaccagagttttcacctggagtccctttcagactctagccat
gaggaaaagagatggctgacagatgaacgtatccctgcttgcacgctggcgcatgctctt
acatatttcattgatgtcacaactccaccttcgcaaagcctgctgcgcaaactctcaaca
gtggcgggtcaagaagaggatcgcaaacgacttgaagcacttgcatctgatttccaggaa
tactctacatggaaagatttctacaggcccaccttcttggaggtgctcgaagaatttccc
tctctgaaggtccctgccaccttccttctcagccagcttcctctgctgaagcctcgtctg
tactcggtcagctcctcattggaccgtcatccgaacgaactacacctcactgtatctgtg
gtggagtaccacactcagggtggaaaaggcccactacattttggcacctgcagcacatgg
cttaacaccatcaaaagaggacacacagttccctgctttgttcaccgctcgggtggattc
catctcccagaagaccccagcactccagttattctgataggagctggtagtggtattgct
cctttccgtagcttctggcaacagcgcatccatgacatgaaaaagacaggtctgcaagtt
agtcctatgacactgctatttgggtgtcgtgattcagaatcagaccatctgtataaagta
gaaacactgaagttgagacttgatggcattctgggcaatgtcaacacagcttactctcgg
caacctggtaaaccaaagatgtatgtgcaggatgtcttgagggagcagctctctgaaaaa
gccgtggaggttctacacaaaaacgcaggtcatctgtatgtctgcggtggcatgaacatg
gcccgagatgttgctggcactttgcaggatatcctggcaagtaaaacaggcatggccatt
gcagaagctggagaatatctggagagaatgaaggttgagaagagataccatgaagacatt
tttggagcttaa

DBGET integrated database retrieval system