KEGG   Sinocyclocheilus grahami: 107553709
Entry
107553709         CDS       T04918                                 

Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform-like isoform X1
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04020  Calcium signaling pathway
sgh04114  Oocyte meiosis
sgh04218  Cellular senescence
sgh04310  Wnt signaling pathway
sgh04370  VEGF signaling pathway
sgh04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107553709
   04310 Wnt signaling pathway
    107553709
   04370 VEGF signaling pathway
    107553709
   04020 Calcium signaling pathway
    107553709
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107553709
   04218 Cellular senescence
    107553709
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107553709
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sgh01009]
    107553709
Enzymes [BR:sgh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     107553709
Protein phosphatases and associated proteins [BR:sgh01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     107553709
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 107553709
NCBI-ProteinID: XP_016091510
UniProt: A0A672SQI6
LinkDB
Position
Unknown
AA seq 511 aa
MSGKEQNKQSTTERLVKAVPYPPTTRLTMKELYEDGKPKVELLKSHLVKEGRLEEDAALR
IINDGANILRHEKCMLEVEAPITVCGDVHGQFFDLMKLFEVGGSPHNTRYLFLGDYVDRG
YFSIECVLYLWTLKINHPTTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMEAFD
CLPLAALLNQQFLCVHGGLSPEVTCLDDIRKLDRFKEPPAFGPMCDLLWSDPGEDYGSEK
SSEHFCHNSVRGCSYFYSYPAVCDFLMNNNLLSVIRAHEAQDAGYRMYRKSQTTGFPSLI
TIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTE
MLVNVLNICSDDELMSEGDDTCEGGTPAVRKEVIRNKIRAIGKMARVFSVLREENESVLQ
LKGLTPTGTLPLGVLSGGRQTLQSATVEAEEARAIQGFNPQHKIQSFEEARGLDRINERM
PPRKDSMQPDGTANSINAANSPDKNGTNAQA
NT seq 1536 nt   +upstreamnt  +downstreamnt
atgtcggggaaggagcagaataaacaatccaccaccgaacggctcgtcaaagcagtgccg
taccctcccacaacgcggctcaccatgaaagagctgtacgaggacggcaagcccaaggtg
gagcttttgaagagccacctggtgaaagaggggcgcctggaggaagacgctgccctacgc
atcatcaacgatggcgccaacatcctccgccatgagaaatgcatgctggaagtggaggcc
cccatcacggtgtgcggagacgtccatgggcagttttttgacctgatgaagctctttgag
gtggggggttcccctcacaatacacgctatctatttttgggagactatgtggatcgaggc
tatttcagtattgagtgtgtgctctatctgtggaccctgaagatcaaccacccgaccacc
ctcttcctcctcagaggcaaccacgagtgtcggcatctcacggagtatttcacctttaaa
caagaatgcaagattaagtactcggagcgcgtgtatgacgcctgcatggaggcctttgac
tgccttcccctggccgctctgctcaaccagcagttcctgtgcgttcacggaggcctgtcc
cccgaggtcacctgcctcgacgacatccggaaattagacaggtttaaagagcctccagct
ttcgggccgatgtgcgacctgctgtggtctgaccctggcgaggactacggcagcgaaaag
agctctgagcacttttgtcacaacagtgtgagaggatgttcctatttctacagttaccct
gcagtgtgtgactttctgatgaataataacttgttgtcagttataagagcacatgaagcc
caagacgcagggtatcgaatgtacagaaaaagtcagacgacaggcttcccctctttaatc
acaatcttctctgcaccaaactacttagatgtgtataacaataaagctgctgtgttgaaa
tacgagaacaacgtcatgaacatccggcagttcaattgctctcctcacccgtactggctg
cccaacttcatggacgtgttcacgtggtcactgcccttcgtcggggagaaagtaacagag
atgctggtcaacgtgttaaacatctgctcagatgatgagctcatgtccgagggagacgac
acatgtgaaggtggcaccccggcagtccgcaaggaggtgatccgaaataagattcgtgcc
attggcaagatggccagagttttctctgttcttagagaggagaatgagagtgtgttgcag
ttaaagggcttgacccccactgggacgttgcctctgggtgtgctatcaggaggcagacag
accctacagagcgccaccgtagaagcagaggaagcacgagccatccaagggttcaaccct
caacacaagatccaaagcttcgaggaagcacgcggactggaccggataaacgagcgaatg
cctccacgcaaggacagcatgcagccagacggcactgccaactccatcaacgcagccaat
tcccccgacaagaacggcaccaacgcacaggcgtag

KEGG   Sinocyclocheilus grahami: 107557026
Entry
107557026         CDS       T04918                                 

Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform-like
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04020  Calcium signaling pathway
sgh04114  Oocyte meiosis
sgh04218  Cellular senescence
sgh04310  Wnt signaling pathway
sgh04370  VEGF signaling pathway
sgh04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107557026
   04310 Wnt signaling pathway
    107557026
   04370 VEGF signaling pathway
    107557026
   04020 Calcium signaling pathway
    107557026
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107557026
   04218 Cellular senescence
    107557026
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107557026
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sgh01009]
    107557026
Enzymes [BR:sgh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     107557026
Protein phosphatases and associated proteins [BR:sgh01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     107557026
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 107557026
NCBI-ProteinID: XP_016095813
LinkDB
Position
Unknown
AA seq 374 aa
MGNSVTNVRESVSSFKQRGYGLVRGQRVKCVLYLWSLKMLYPKTLFLLRGNHECRHLTEY
FTFKQECKIKYSEQVYDACMGAFDCLPLAALMNQQFLCVHGGLSPEIQTLDDIKKLDRFK
EPPAFGPMCDLLWSDPLEDFGNEKSQEYFSHNTVRGCSYFYSYPAVCDFLQNNNLLSIIR
AHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPH
PYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSDDELMNDGDEIFDANAAAARKEVIRN
KIRAIGKMAKMFSVLREESENVLTLKGLTPTGMLPSGVLSGGKQTLQSATTEAIEAIETD
EDGEGHLPYYLVSQ
NT seq 1125 nt   +upstreamnt  +downstreamnt
atgggcaattctgtcacaaacgtcagggaatcagtgtccagcttcaaacagcgaggatat
ggtttggtccgagggcagcgagtgaagtgtgttctgtacctctggtcactgaaaatgctc
tacccaaagacgctatttttactgagaggaaatcatgaatgtagacatttgacagaatat
ttcaccttcaaacaagaatgtaaaatcaagtattcagagcaggtttacgatgcctgtatg
ggcgcgtttgactgtctgcccttggcagctctcatgaaccagcagttcctgtgcgtccac
ggtggcctgtccccagaaatacagaccttagatgacataaagaagttggaccggtttaag
gagcccccagcattcgggcctatgtgtgatttgctttggtccgatcccctggaggacttc
ggcaatgaaaagagccaagagtactttagccacaacacagtgagaggatgctcatacttc
tacagttatccagctgtctgtgacttcctacagaataataacttgttatcaatcatccga
gcacacgaagcacaagatgcagggtatcggatgtacaggaagagtcagactactggcttc
ccttccctaattaccatcttctctgcaccaaactaccttgatgtttacaacaataaagct
gccgttctgaagtatgagaacaatgtaatgaacatccggcagtttaactgctcccctcat
ccttactggctgccaaatttcatggatgtctttacctggtcacttccatttgtgggggag
aaagtcacggagatgctggtaaatgtgttgagcatctgttctgacgatgagctgatgaat
gatggagacgaaatctttgacgccaatgcagcagctgctcggaaagaggtgattaggaac
aagatccgtgccattgggaagatggccaagatgttctccgtgctcagagaggagagtgag
aatgtgttgaccctgaagggcctgacccctaccggcatgctgcccagcggggtgctttct
ggaggcaagcagactctgcagagtgcaaccaccgaagccattgaagccatcgagacggat
gaagacggagaagggcacctgccttactacctggtcagtcaatga

KEGG   Sinocyclocheilus grahami: 107558205
Entry
107558205         CDS       T04918                                 

Definition
(RefSeq) calcineurin subunit B type 1-like
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04020  Calcium signaling pathway
sgh04114  Oocyte meiosis
sgh04218  Cellular senescence
sgh04310  Wnt signaling pathway
sgh04370  VEGF signaling pathway
sgh04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107558205
   04310 Wnt signaling pathway
    107558205
   04370 VEGF signaling pathway
    107558205
   04020 Calcium signaling pathway
    107558205
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107558205
   04218 Cellular senescence
    107558205
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107558205
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sgh01009]
    107558205
Protein phosphatases and associated proteins [BR:sgh01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     107558205
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Other DBs
NCBI-GeneID: 107558205
NCBI-ProteinID: XP_016097315
LinkDB
Position
Unknown
AA seq 166 aa
MGNEASYPLEMCTHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIE
IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV
GNNLKDTQLQQIVDKTIVNADKDGDGRISFEEFCAVSLAASQISTA
NT seq 501 nt   +upstreamnt  +downstreamnt
atgggaaatgaggcaagttatcccctggaaatgtgcacgcatttcgatgctgatgagatt
aaaaggctgggaaagaggtttaagaaactcgacctagataactccggatccctcagcgtg
gaggagttcatgtccttgcccgagttacagcagaatccactggtgcagagagtcatcgag
atattcgacacggacggcaacggagaggtggacttcaaagagttcatagagggcgtctct
cagttcagtgtgaagggcgataaggagcagaaactgcgcttcgcttttaggatctatgac
atggacaaggacggctacatttccaacggagagctgttccaggtgctgaagatgatggtg
ggcaacaatctgaaggacactcagctgcagcagatcgtggacaagaccatcgtcaacgca
gacaaggacggcgatgggagaatatccttcgaggagttctgtgctgtaagtctggctgcc
agtcagatctccactgcttga

KEGG   Sinocyclocheilus grahami: 107559060
Entry
107559060         CDS       T04918                                 

Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform-like
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04020  Calcium signaling pathway
sgh04114  Oocyte meiosis
sgh04218  Cellular senescence
sgh04310  Wnt signaling pathway
sgh04370  VEGF signaling pathway
sgh04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107559060
   04310 Wnt signaling pathway
    107559060
   04370 VEGF signaling pathway
    107559060
   04020 Calcium signaling pathway
    107559060
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107559060
   04218 Cellular senescence
    107559060
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107559060
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sgh01009]
    107559060
Enzymes [BR:sgh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     107559060
Protein phosphatases and associated proteins [BR:sgh01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     107559060
SSDB
Motif
Pfam: Metallophos Chromo Mtf2_C
Other DBs
NCBI-GeneID: 107559060
NCBI-ProteinID: XP_016098282
LinkDB
Position
Unknown
AA seq 580 aa
MGRVCTEFTPQTCDRYHPIPMCSGVPTPIIPMVRGTIRTHGYNEARRRGMRLTFISREQS
TKQRNKLTAIGAPIPTISLPAGGPRGAEDQEEAGDQRVSPITIDGEEAYRVREILDSRRR
GRMIQYLVDWEGYVCGDIHGQFFDLMKLFEVGGSPASTRYLFLGDYVDRGYFSIECVLYL
WALKILYPKTLFLLRGNHECRHLTEYFTFKQECRIKYSERVYDACMDAFDCLPLAALMNQ
QFLCVHGGLSPEITNLDDIRKLDRFKEPPAYGPMCDLLWSDPLEDFGNEKTQEHFTHNTV
RGCSYFYSYPAACDFLQHNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLD
VYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICS
NDELTTDEEIDGQLIYGPKKGATASARKEVIRNKIRAIGKMARVFSVLREESESVLTLKG
LTPTGMLPSGVLSGGKEKLQNETAATIEAIEADKAIKGFSPQHKINSFEEAKGLDRINER
MPPRRDAMPCDASLNSLNKALSSETNGTEGKACSGSGNIQ
NT seq 1743 nt   +upstreamnt  +downstreamnt
atgggccgagtatgcacagagttcactccgcaaacctgcgacaggtatcaccccattcca
atgtgttctggtgttccaacccccattattcctatggtccggggaaccatcagaactcat
ggctacaacgaagcgaggagacgtggaatgaggctcacgttcatctccagagagcagtcc
accaaacaacggaacaagctaaccgccatcggcgcgccaatcccaactatcagcctgccc
gctggtggtccgagaggagcggaggaccaggaggaggctggtgaccaaagagtctctccc
atcaccatagacggcgaagaggcttaccgagttcgggaaatcctggactctcgtcgccgg
ggcagaatgatccagtacctagtggactgggaggggtacgtttgtggagacattcatggg
cagttctttgacttgatgaagctctttgaggtaggagggtctccagccagcacacgatac
cttttcctgggtgattatgtggacagaggatatttcagtattgaatgtgtactgtaccta
tgggccttaaaaatcctttatcccaagacactgtttttgctgcgtgggaaccacgaatgt
agacatttaacagagtatttcacttttaaacaggaatgtagaattaaatattcagagcgg
gtgtatgatgcgtgtatggatgcctttgactgtcttcccctggcagcgctgatgaaccag
cagttcttgtgtgtgcacggtggattgtcccccgaaatcacaaaccttgatgacatcagg
aaattagacagattcaaagagcctcccgcatatggaccaatgtgtgacttgctttggtcg
gacccactggaggactttggcaacgagaaaacccaggaacatttcacacacaacacagtg
agaggctgctcctatttctacagttaccctgctgcgtgtgactttctacaacacaacaac
ttattatctatcatacgagcccatgaagcacaggatgctgggtatcgcatgtacagaaag
agtcaaactacaggcttcccctctctcatcactatcttctcagctcccaactacttagat
gtctacaataacaaagctgctgtcctgaaatatgagaataatgtcatgaacattcggcag
tttaactgttctcctcatccttactggctgcctaacttcatggatgtcttcacttggtcc
ttgccttttgttggggagaaagtgactgagatgcttgtaaatgtcttgagcatctgctcc
aatgatgagctgaccactgatgaagagatagatggacagctaatatatgggcccaagaaa
ggtgccacggcttctgcacgcaaggaggtaatccgaaacaagatccgtgccattggaaag
atggctcgggttttctcagttcttcgagaggagagtgagagcgttttgacgttgaagggt
ctcactccgactggcatgctacccagtggcgttctgtctggaggcaaagagaaactccag
aatgaaactgcagctactattgaggctatagaggcagataaagcaattaaaggcttctca
cctcagcacaagatcaacagctttgaggaggctaaagggctggaccgcatcaatgagcga
atgccaccccgccgtgacgccatgccctgtgacgccagcctcaactcccttaataaggct
ctgtcatcagagaccaatggcactgagggcaaggcctgcagcggcagcggtaatatccag
tga

KEGG   Sinocyclocheilus grahami: 107559267
Entry
107559267         CDS       T04918                                 

Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform-like
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04020  Calcium signaling pathway
sgh04114  Oocyte meiosis
sgh04218  Cellular senescence
sgh04310  Wnt signaling pathway
sgh04370  VEGF signaling pathway
sgh04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107559267
   04310 Wnt signaling pathway
    107559267
   04370 VEGF signaling pathway
    107559267
   04020 Calcium signaling pathway
    107559267
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107559267
   04218 Cellular senescence
    107559267
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107559267
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sgh01009]
    107559267
Enzymes [BR:sgh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     107559267
Protein phosphatases and associated proteins [BR:sgh01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     107559267
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 107559267
NCBI-ProteinID: XP_016098505
LinkDB
Position
Unknown
AA seq 455 aa
MRMSSTDIVGLNPTDRLIKSVPFPLSHRLTMREVFDCEGKPRVDLLKAHLTKEGRLEEPV
ALRIINEGAAILRQEKTMLDIEAPVTVCGDIHGQFFDLMKLFEVGGSPATTRYLFLGDYV
DRGYFSIECVLYLWSLKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSEQVYDVCMD
AFDCLPLAALMNQQFLCVHGGLSPEIHTLDDIKKLDRFKEPPAFGPMCDLLWSDPLEDFG
NEKSQDYFSHNSVRGCSYFYSYPAVCEFLQTNNLLSVIRAHEAQDAGYRMYRKSQTTGFP
SLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEK
VTEMLVNVLSICSDDELMNDGDEIFDVFFSLSFFLIAIRGFSPQHKINSFEEAKGLDRIN
ERMPPRRDVVNSVGLSMGKMNMAESNGTDDNSNIQ
NT seq 1368 nt   +upstreamnt  +downstreamnt
atgagaatgtccagcacagacatcgtgggtttaaaccctaccgaccgcctaatcaaatcg
gtgccgttcccgctgagccacaggttaaccatgcgagaggtgttcgactgtgaggggaaa
ccgcgtgtggacctgctgaaggctcacctcactaaagagggtcgcttggaggagcctgtc
gccctgcgtatcatcaacgagggggccgccatcctccgccaggagaagaccatgctggac
atagaggcccctgtcacagtgtgcggggatattcacgggcagttcttcgacctgatgaag
ttatttgaggttggcgggtctcctgcgacaacgaggtacttgtttctaggggactatgtg
gaccgagggtacttcagtattgagtgtgtcctttacctctggtcgctgaaaatcctctac
ccaaagacgctgtttctgctgcggggaaaccatgaatgtagacatttgactgaatatttc
actttcaaacaagaatgtaaaatcaaatactcggagcaggtgtatgatgtgtgcatggat
gcattcgactgtctgcctctggctgctctgatgaatcagcagtttttgtgtgttcatggt
ggcctgtctccagagatacacactttagacgacatcaagaagctggacaggttcaaggaa
ccaccagcgtttggccccatgtgtgatctgctgtggtccgacccgctggaggacttcggc
aatgaaaagagtcaagattacttcagccacaacagtgtccgcggatgctcctacttctac
agctatcctgcggtgtgtgagtttttacagaccaacaacttactgtctgtcatcagagca
catgaggcgcaggacgcgggttaccgtatgtacaggaagagtcagactacaggttttcct
tctctcatcaccatcttttctgctccaaactacctggacgtttacaacaacaaagcggcc
gtgcttaaatacgagaacaacgtaatgaacatacgacagttcaactgctcgccacatccg
tactggctgcccaacttcatggacgtcttcacctggtctcttccgttcgttggggagaaa
gtgacagaaatgttggtgaatgtcctcagtatctgctctgatgatgagcttatgaacgac
ggagatgagatctttgatgtcttcttttctctctccttttttctcatagccatccgtggc
ttttctccacagcacaagatcaacagtttcgaggaggcgaagggtctggaccgcataaac
gagcgaatgccgcctcgccgagacgtggtcaacagcgtggggctgtcaatgggcaagatg
aacatggccgaatccaacggcacggacgacaacagcaatatccagtga

KEGG   Sinocyclocheilus grahami: 107561987
Entry
107561987         CDS       T04918                                 

Gene name
ppp3r1
Definition
(RefSeq) calcineurin subunit B type 1 isoform X1
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04020  Calcium signaling pathway
sgh04114  Oocyte meiosis
sgh04218  Cellular senescence
sgh04310  Wnt signaling pathway
sgh04370  VEGF signaling pathway
sgh04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107561987 (ppp3r1)
   04310 Wnt signaling pathway
    107561987 (ppp3r1)
   04370 VEGF signaling pathway
    107561987 (ppp3r1)
   04020 Calcium signaling pathway
    107561987 (ppp3r1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107561987 (ppp3r1)
   04218 Cellular senescence
    107561987 (ppp3r1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107561987 (ppp3r1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sgh01009]
    107561987 (ppp3r1)
Protein phosphatases and associated proteins [BR:sgh01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     107561987 (ppp3r1)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Other DBs
NCBI-GeneID: 107561987
NCBI-ProteinID: XP_016102029
LinkDB
Position
Unknown
AA seq 185 aa
MALRYDEMGKPLCVVTRARPAAAKDPVTGFDADEIKRLGKRFKKLDLDNSGSLSVEEFMS
LPELQQNPLVQRVIEIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDG
YISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKK
MVVDV
NT seq 558 nt   +upstreamnt  +downstreamnt
atggctcttcggtacgatgagatgggcaaacctctgtgtgtggtgacccgcgcaaggcca
gcggcagccaaggatcccgtcacgggattcgatgctgatgagattaaaaggctgggaaag
aggtttaagaaactcgacctagataactcaggatccctcagcgtggaggagttcatgtcc
ttgcccgagttacagcagaatccactggtgcagagagtcatcgagatattcgacacggac
ggcaacggagaggtggacttcaaagagttcatagagggcgtctctcagttcagtgtgaag
ggcgataaggagcagaaactgcgcttcgcttttaggatctatgacatggacaaggacggc
tacatttccaacggagagctgttccaggtgctgaagatgatggtgggcaacaatctgaag
gacactcagctgcagcagatagtggacaagaccatcatcaacgcagacaaggacggcgat
gggagaatatccttcgaggagttctgtgctgtcgtcggaggcctggatatacacaagaag
atggtggtggatgtgtga

KEGG   Sinocyclocheilus grahami: 107571543
Entry
107571543         CDS       T04918                                 

Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform-like isoform X1
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04020  Calcium signaling pathway
sgh04114  Oocyte meiosis
sgh04218  Cellular senescence
sgh04310  Wnt signaling pathway
sgh04370  VEGF signaling pathway
sgh04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107571543
   04310 Wnt signaling pathway
    107571543
   04370 VEGF signaling pathway
    107571543
   04020 Calcium signaling pathway
    107571543
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107571543
   04218 Cellular senescence
    107571543
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107571543
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sgh01009]
    107571543
Enzymes [BR:sgh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     107571543
Protein phosphatases and associated proteins [BR:sgh01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     107571543
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 107571543
NCBI-ProteinID: XP_016113350
UniProt: A0A672PM50
LinkDB
Position
Unknown
AA seq 521 aa
MKMSNADMVLNSTDRVVKSVPFPLSHRLTMKEVFDCEGKPRVDLLKAHLTKEGRVEETVA
LRIINEGASILRQEKTMLDIEAPVTVCGDIHGQFFDLMKLFEVGGSPATTRYLFLGDYVD
RGYFSIECVLYLWSLKMLYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSEQVYDACMGA
FDCLPLAALMNQQFLCVHGGLSPEIQTLDDIKKLDRFKEPPAFGPMCDLLWADPLEDFGN
EKSQEYFSNNTVRGCSYFYSYPAVCDFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPS
LITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKV
TEMLVNVLSICSDDELMNDGDEIFDANAAAARKEVIRNKIRAIGKMAKMFSVLREESENV
LTLKGLTPTGMLPSGVLSGGKQTIQSATVEAIEAIETEEDGEAIRGFSPQHKINSFEEAK
GLDRINERMPPRKDGVNHVGHSMGKMNMSETNGTDDNSNIQ
NT seq 1566 nt   +upstreamnt  +downstreamnt
atgaagatgtctaacgctgacatggtcttgaactccaccgatcgggtagtgaaatccgtt
cccttccctctgagtcaccgcctcaccatgaaggaggtgtttgattgtgaggggaaacca
agggtggatctactgaaagcccacctcactaaagagggccgagtggaggagaccgtggcc
cttcgaatcataaatgaaggggcctctatcttacgccaggagaagaccatgctggacata
gaggcacctgtcacagtgtgcggtgacatccatggtcagtttttcgacctgatgaaactg
tttgaggtgggaggctctccagccacgacacgatacctcttcctgggtgactatgtggac
cggggttacttcagtatcgagtgtgttctgtacctctggtcactgaaaatgctctaccca
aagacgctatttttactgagaggaaatcatgaatgtagacatttgacagaatatttcacc
ttcaaacaagaatgtaaaatcaagtattcagagcaggtttacgatgcctgtatgggcgca
tttgactgtctgcccttggcagctctcatgaaccagcagttcctgtgcgtccacggtggc
ctgtccccagaaatacagaccttagacgacataaagaagttggaccggtttaaggagccc
ccagcattcgggcctatgtgtgatttgctttgggctgatcccttggaggacttcggcaat
gaaaagagccaagagtactttagcaacaacacagtcagaggatgctcatatttctacagt
tatccggctgtctgtgacttcctacagaataataacttgttatcaatcattcgagcacat
gaagcacaggatgcagggtaccggatgtacaggaagagtcagaccactggcttcccttcc
ctaattaccattttctctgcgccaaactaccttgatgtttacaataataaagctgccgtc
ctgaagtatgagaacaatgtaatgaacatccggcagtttaactgctcccctcatccttac
tggctgcccaatttcatggatgtcttcacctggtcgctgccatttgtgggggagaaagtc
acggagatgctggtaaatgtgttgagcatctgttctgatgatgagctgatgaatgatgga
gacgagatctttgacgccaatgcagcagctgctcggaaagaggtgattaggaacaagatc
cgtgccattgggaagatggccaagatgttctccgtgctcagagaggagagtgagaatgtg
ttgaccctgaagggtctgacccctaccgggatgctccccagcggggtgctttctggaggc
aagcagactatacagagtgcaaccgtcgaagccattgaagccatcgagacggaagaagat
ggagaagccatccgcggcttctctccacagcacaagatcaacagcttcgaagaggctaaa
ggtctggaccgcatcaacgaacgcatgccaccccgcaaggatggagtcaaccacgtgggc
cactccatgggcaagatgaacatgtccgagaccaacggcactgatgacaacagtaacatc
cagtga

KEGG   Sinocyclocheilus grahami: 107577029
Entry
107577029         CDS       T04918                                 

Definition
(RefSeq) calcineurin subunit B type 1-like
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04020  Calcium signaling pathway
sgh04114  Oocyte meiosis
sgh04218  Cellular senescence
sgh04310  Wnt signaling pathway
sgh04370  VEGF signaling pathway
sgh04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107577029
   04310 Wnt signaling pathway
    107577029
   04370 VEGF signaling pathway
    107577029
   04020 Calcium signaling pathway
    107577029
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107577029
   04218 Cellular senescence
    107577029
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107577029
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sgh01009]
    107577029
Protein phosphatases and associated proteins [BR:sgh01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     107577029
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Other DBs
NCBI-GeneID: 107577029
NCBI-ProteinID: XP_016118636
LinkDB
Position
Unknown
AA seq 151 aa
MTMTARQEKLVDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDT
DGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNL
KDTQLQQIVDKTIINADKDGDGRISFEEFCI
NT seq 453 nt   +upstreamnt  +downstreamnt
atgaccatgactgccaggcaggagaaactggttgacgctgatgagattaaaagactaggg
aagcggtttaagaaactcgacctggataactcgggttctctcagcgtggaggagtttatg
tctctacccgagttgcagcagaatccgctggtgcagcgagtaatcgatatattcgacaca
gacggaaatggagaagtggactttaaagagttcattgaaggcgtctctcagttcagtgtc
aagggtgacaaagagcagaagctccgctttgcgttcaggatttatgacatggataaggat
ggctacatatccaacggtgagctgttccaagtgctgaagatgatggtagggaataacctg
aaggacacccagctgcagcagatcgtcgacaaaaccatcatcaacgcagacaaggatggg
gatggaaggatatctttcgaggagttctgcatt

KEGG   Sinocyclocheilus grahami: 107583200
Entry
107583200         CDS       T04918                                 

Definition
(RefSeq) calcineurin subunit B type 1-like
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04020  Calcium signaling pathway
sgh04114  Oocyte meiosis
sgh04218  Cellular senescence
sgh04310  Wnt signaling pathway
sgh04370  VEGF signaling pathway
sgh04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107583200
   04310 Wnt signaling pathway
    107583200
   04370 VEGF signaling pathway
    107583200
   04020 Calcium signaling pathway
    107583200
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107583200
   04218 Cellular senescence
    107583200
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107583200
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sgh01009]
    107583200
Protein phosphatases and associated proteins [BR:sgh01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     107583200
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_4 SPARC_Ca_bdg EF-hand_9
Other DBs
NCBI-GeneID: 107583200
NCBI-ProteinID: XP_016124819
LinkDB
Position
Unknown
AA seq 160 aa
MCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEV
DFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQ
QIVDKTIINADKDGDGRISFEEFCIVVGGLDIHKKMVVDV
NT seq 483 nt   +upstreamnt  +downstreamnt
atgtgctcacactttgatgctgatgagattaaaagactaggaaagcggtttaagaaactc
gacctggataactcgggttctctcagtgtggaggagtttatgtctctaccagagttgcag
cagaacccgctggtgcagcgagtcatcgatatattcgacacagacggaaatggagaagtg
gactttaaagagttcattgaaggcgtctctcagttcagcgtcaagggcgacaaggagcag
aagctccgctttgcgttcaggatttatgacatggataaggatggctacatatccaacggt
gagctgttccaggtgctgaagatgatggtagggaataacctgaaggacacccagctgcag
cagattgtcgacaaaaccatcatcaacgcagacaaggatggggacgggaggatatctttc
gaggagttctgcattgtggttggtggcttagacattcacaaaaagatggtggtggacgtg
tga

KEGG   Sinocyclocheilus grahami: 107586120
Entry
107586120         CDS       T04918                                 

Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform-like isoform X1
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04020  Calcium signaling pathway
sgh04114  Oocyte meiosis
sgh04218  Cellular senescence
sgh04310  Wnt signaling pathway
sgh04370  VEGF signaling pathway
sgh04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107586120
   04310 Wnt signaling pathway
    107586120
   04370 VEGF signaling pathway
    107586120
   04020 Calcium signaling pathway
    107586120
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107586120
   04218 Cellular senescence
    107586120
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107586120
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sgh01009]
    107586120
Enzymes [BR:sgh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     107586120
Protein phosphatases and associated proteins [BR:sgh01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     107586120
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 107586120
NCBI-ProteinID: XP_016128837
UniProt: A0A672S0G6
LinkDB
Position
Unknown
AA seq 511 aa
MSGKEQNKQSTTERLVKAVPYPPTTRLTMKELYEDGKPKVELLKSHLVKEGRLEEDAALR
IINDGANILRHEKCMLEVEAPITVCGDVHGQFFDLMKLFEVGGSPHNTRYLFLGDYVDRG
YFSIECVLYLWALKINHPTTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDSCMEAFD
CLPLAALLNQQFLCVHGGLSPEITCLDDIRKLDRFKEPPAFGPMCDLLWSDPGEDYGSEK
SSEHFCHNSVRGCSYFYSYPAVCDFLMNNNLLSVIRAHEAQDAGYRMYRKSQTTGFPSLI
TIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTE
MLVNVLNICSDDELMSEGDDTCEGGTPAVRKEVIRNKIRAIGKMARVFSVLREENESVLQ
LKGLTPTGTLPLGVLSGGRQTLESATVEAEEARAIQGFNPQHKIQSFEEARGLDRINERM
PPRKDTMQPDGTANSINAANSPDKNGTNAQA
NT seq 1536 nt   +upstreamnt  +downstreamnt
atgtcggggaaggagcagaataaacaatccaccaccgaacggctcgtcaaagcagtgccg
taccctcccacgacgcggctcaccatgaaagagctgtatgaggacggcaagcccaaggtg
gagcttttgaagagccacctggtgaaagagggccgcctggaggaagatgcggccctacgc
atcatcaacgacggcgccaacatcctccgccacgagaaatgcatgctggaagtggaggcc
cccatcacagtgtgcggagatgtccatgggcagttttttgacctgatgaagctctttgag
gtggggggttccccgcacaacacgcgctatctatttttgggagactatgtggatcgaggc
tatttcagtattgagtgtgtgctctatctgtgggccttgaagattaaccatccgaccacc
ctcttcctcctcagaggcaaccacgagtgtcggcatctcacggagtacttcacctttaaa
caagaatgcaagattaagtactcagagcgcgtgtatgattcctgcatggaggcctttgac
tgccttcccctggccgctctgctcaaccagcagttcctgtgcgttcacggaggcctgtcc
cccgagatcacctgcctcgacgacatccggaaattagacaggtttaaagagccgccagct
tttgggccgatgtgcgacctgctgtggtctgaccctggtgaggactacggcagcgaaaag
agctcggagcacttttgtcacaacagtgtgagaggatgttcctatttctacagttaccct
gcagtatgtgactttctgatgaataacaacttgttgtcagttataagagcacatgaagcc
caagatgcagggtatcgaatgtacagaaaaagtcagacgacaggcttcccctctttaatc
acaatcttctccgcaccaaactacttggatgtgtataacaataaagctgctgtgttgaaa
tacgagaacaacgtcatgaacatccggcagttcaattgctctcctcacccatactggctg
cccaatttcatggacgtgttcacgtggtcactgcccttcgtcggggagaaagtaacagag
atgctagtcaacgtgttaaacatttgctcagatgatgagctcatgtcagagggagatgac
acatgtgaaggtggcaccccggcagtccgcaaggaggtgatccgaaataagattcgtgcc
attggcaagatggccagagttttctctgttcttagagaggagaacgagagtgtgttgcag
ttaaagggcttgacccccactgggacattgcctctgggtgtgctgtcaggaggcagacag
accctagagagcgccaccgtagaagcagaggaagcacgagccatccaaggcttcaaccct
caacacaagatccaaagcttcgaggaagcacgcggactggaccggataaacgaacgaatg
cctccacgcaaggacaccatgcagccagacggcactgccaactccatcaacgcagccaat
tcccccgacaagaacggcaccaacgcacaggcgtag

KEGG   Sinocyclocheilus grahami: 107587417
Entry
107587417         CDS       T04918                                 

Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform-like
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04020  Calcium signaling pathway
sgh04114  Oocyte meiosis
sgh04218  Cellular senescence
sgh04310  Wnt signaling pathway
sgh04370  VEGF signaling pathway
sgh04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107587417
   04310 Wnt signaling pathway
    107587417
   04370 VEGF signaling pathway
    107587417
   04020 Calcium signaling pathway
    107587417
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107587417
   04218 Cellular senescence
    107587417
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107587417
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sgh01009]
    107587417
Enzymes [BR:sgh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     107587417
Protein phosphatases and associated proteins [BR:sgh01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     107587417
SSDB
Motif
Pfam: Metallophos PTEN_C2
Other DBs
NCBI-GeneID: 107587417
NCBI-ProteinID: XP_016130703
LinkDB
Position
Unknown
AA seq 356 aa
MGKEAGTVPLPPHQRLTVKDLYVDGKPNAEILKNHLIKEGRVEEDVALRIINEGANILRQ
EKCMLEVEAPITVCGDVHGQFFDLMKLFEVGGSPDNTRYLFLGDYVDRGYFSIESYLSVC
LCFLTGKIKYSERVYDACMEAFDCLPLAALLNQQFLCVHGGLSPEINCLDDIRKLDRFKE
PPAFGPMCDLIWADPGEDYGSEKTVEHFNHNSVRGCSYFYSYAAVCDFLTNNNLLSVIRA
HEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHP
YWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELMSEGDDLCEGKVVHTHTHV
NT seq 1071 nt   +upstreamnt  +downstreamnt
atgggcaaagaggcgggaacagtgccactgccccctcaccagcgactgacagtgaaggac
ctatatgtggatggtaagcccaatgctgagatactgaagaaccatttgatcaaagaggga
cgtgtggaggaagacgttgcgctgcgcatcataaacgagggtgccaacatcctaaggcag
gagaagtgcatgctagaggtggaggctccaatcactgtatgtggtgacgttcacggacag
ttcttcgacctcatgaagctctttgaagttggtggttcccccgacaacacgcgctatctc
ttcctgggcgattatgtggacagaggatacttcagtattgagtcatacttgtctgtctgt
ctttgtttccttacaggtaaaataaagtattcagagagggtttatgacgcatgtatggag
gcctttgactgcttgcctcttgcagctcttctaaaccagcagttcctctgtgtacatggt
ggcctctcaccagaaatcaactgcttagatgacattaggaaattagacaggtttaaggag
cccccggcatttgggcctatgtgtgatttgatctgggccgacccgggagaggactatggc
agtgagaagacggtagagcattttaaccacaactcagtcagaggatgctcctatttctac
agttatgcagcagtctgtgactttctgacaaacaataacctgttgtcagtaattagagca
catgaagcacaggacgcagggtacaggatgtacagaaaaagtcagacaacaggcttccct
tcattaattaccattttctcagcaccaaattacctagatgtctataacaacaaagcggct
gtattgaaatatgaaaacaatgtcatgaacattaggcagttcaactgctctcctcacccg
tactggttacccaactttatggatgtgtttacgtggtcgctgccctttgtgggcgagaaa
gtgactgagatgttggtgaatgtcttaaacatctgctctgatgatgaactcatgtcagag
ggagacgacttatgtgaaggtaaggttgttcacacacacacacatgtataa

KEGG   Sinocyclocheilus grahami: 107589094
Entry
107589094         CDS       T04918                                 

Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform-like isoform X1
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04020  Calcium signaling pathway
sgh04114  Oocyte meiosis
sgh04218  Cellular senescence
sgh04310  Wnt signaling pathway
sgh04370  VEGF signaling pathway
sgh04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107589094
   04310 Wnt signaling pathway
    107589094
   04370 VEGF signaling pathway
    107589094
   04020 Calcium signaling pathway
    107589094
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107589094
   04218 Cellular senescence
    107589094
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107589094
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sgh01009]
    107589094
Enzymes [BR:sgh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     107589094
Protein phosphatases and associated proteins [BR:sgh01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     107589094
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 107589094
NCBI-ProteinID: XP_016132913
LinkDB
Position
Unknown
AA seq 522 aa
MRMSSADIVGLNPTDRVIKSVPFPLSHRLSMREVFDCEGKPRVDLLKAHLTKEGRLEEPV
ALRIINEGAAILRQEKTMLDIEAPVTVCGDIHGQFFDLMKLFEVGGSPATTRYLFLGDYV
DRGYFSIECVLYLWSLKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSEQVYDACMD
AFDCLPLAALMNQQFLCVHGGLSPEIHTLDDIKRLDRFKEPPAFGPMCDLLWADPLEDFG
NEKSQDYFSHNSVRGCSYFYSYPAVCEFLQTNNLLSVIRAHEAQDAGYRMYRKSQTTGFP
SLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEK
VTEMLVNVLSICSDDELMNDEDEIFDANAAAARKEVIRNKIRAIGKMAKMFSVLREESEN
VLTLKGLTPTGMLPSGVLSGGKQTLQSATTEAIEAVETDEDGEAIRGFSPQHKINSFAEA
KGLDRINERMPPRRDVVNSVGLSMGKMNMAESNGTDDNSNIQ
NT seq 1569 nt   +upstreamnt  +downstreamnt
atgagaatgtccagcgcagacatcgtgggtttaaaccctaccgaccgcgtgatcaaatcg
gtgccatttccgctgagccacaggttaagcatgcgagaggtgttcgactgcgaggggaaa
ccgcgggtggacctgctgaaggctcacctcactaaagagggccgcttggaggagcccgta
gctctgcgcatcatcaacgagggggccgccatcctccgtcaggagaagaccatgctggac
atagaggcccctgtcacagtgtgcggggatattcacgggcagttcttcgacctgatgaag
ttatttgaggttggcgggtctcctgcgacaacgaggtacctgtttctaggggactatgtg
gaccgagggtacttcagtattgagtgtgtcctttacctctggtcgctgaaaatcctctac
ccaaagacgctgtttctgctgcggggaaaccatgaatgtagacatttgactgaatatttc
actttcaaacaagaatgtaaaatcaaatactcggagcaggtgtacgacgcgtgcatggat
gcattcgactgtctgcctctggctgctctgatgaatcagcagtttttgtgtgttcatggc
ggcctgtctccagagatacacacattagatgacattaagaggctggacaggttcaaggaa
ccgccagcatttggccccatgtgtgatctgctctgggctgacccgctggaggactttggc
aatgaaaagagtcaagattacttcagccacaacagtgtccgcggatgctcctacttctac
agctatcctgcagtgtgtgagtttttacagaccaacaacttactgtctgtcatcagggca
cacgaggcacaggatgccggttaccgtatgtacaggaagagtcagactacaggtttccct
tctctcatcaccatcttctcggctccaaactatctggacgtttacaacaacaaagcggcc
gtgcttaaatacgagaacaacgtaatgaacatacgacagttcaactgctcgccacatcca
tactggctgcccaacttcatggacgtcttcacctggtctcttccgttcgttggagagaaa
gtgacagaaatgttggtgaatgtcctcagtatctgctctgatgatgagcttatgaacgat
gaagatgagatctttgatgctaatgctgcggccgcccgtaaagaggtcatcagaaacaag
atccgtgccatcggtaaaatggccaaaatgttctcagtcctgcgagaggagagtgagaat
gtgttaaccctgaaaggtctgacccccaccggcatgctgccgagcggcgtactgtctgga
ggaaaacagaccttgcagagcgctaccaccgaggccattgaagctgtggagacggatgag
gatggagaagccatccgtggcttttctccacagcacaagatcaacagtttcgcggaagcg
aagggtctggaccgcataaacgagcgcatgccgcctcgccgagacgtggtcaacagcgtg
gggctgtcgatgggcaagatgaacatggccgaatccaacggcacggatgacaacagcaat
atccagtga

KEGG   Sinocyclocheilus grahami: 107594412
Entry
107594412         CDS       T04918                                 

Definition
(RefSeq) calcineurin subunit B type 1-like isoform X1
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04020  Calcium signaling pathway
sgh04114  Oocyte meiosis
sgh04218  Cellular senescence
sgh04310  Wnt signaling pathway
sgh04370  VEGF signaling pathway
sgh04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107594412
   04310 Wnt signaling pathway
    107594412
   04370 VEGF signaling pathway
    107594412
   04020 Calcium signaling pathway
    107594412
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107594412
   04218 Cellular senescence
    107594412
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107594412
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sgh01009]
    107594412
Protein phosphatases and associated proteins [BR:sgh01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     107594412
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Other DBs
NCBI-GeneID: 107594412
NCBI-ProteinID: XP_016139926
UniProt: A0A672JVQ1
LinkDB
Position
Unknown
AA seq 166 aa
MTMTARQEKLVDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDT
DGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNL
KDTQLQQIVDKTIINADKDGDGRISFEEFCIVVGGLDIHKKMVVDV
NT seq 501 nt   +upstreamnt  +downstreamnt
atgaccatgactgccaggcaggagaaactggttgacgctgatgagattaaaagactaggg
aagcggtttaagaaactcgacctggataactcgggttctctcagcgtggaggagtttatg
tctctacccgagttgcagcagaatccgctggtgcagcgagtcatcgatatattcgacaca
gacggaaatggagaagtggactttaaagagttcattgaaggcgtctctcagttcagtgtc
aagggtgacaaggagcagaagctccgctttgcgttcaggatttatgacatggataaagat
ggctacatatccaacggtgagctgttccaagtgctgaagatgatggtagggaataaccta
aaggacacccagctgcagcagattgtcgacaaaaccatcatcaacgcagacaaggatggg
gatggaaggatatctttcgaggagttctgcattgtggttggtggcttagacattcacaaa
aagatggtggtggatgtgtga

KEGG   Sinocyclocheilus grahami: 107595030
Entry
107595030         CDS       T04918                                 

Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform-like
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04020  Calcium signaling pathway
sgh04114  Oocyte meiosis
sgh04218  Cellular senescence
sgh04310  Wnt signaling pathway
sgh04370  VEGF signaling pathway
sgh04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107595030
   04310 Wnt signaling pathway
    107595030
   04370 VEGF signaling pathway
    107595030
   04020 Calcium signaling pathway
    107595030
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107595030
   04218 Cellular senescence
    107595030
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107595030
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sgh01009]
    107595030
Enzymes [BR:sgh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     107595030
Protein phosphatases and associated proteins [BR:sgh01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     107595030
SSDB
Motif
Pfam: Metallophos PTEN_C2
Other DBs
NCBI-GeneID: 107595030
NCBI-ProteinID: XP_016140791
LinkDB
Position
Unknown
AA seq 504 aa
MIVSSKNIFDNALQTVPLPPHQRLTIKDLFVDGKPNAELLKNHLIKEGRVEEDVALRIIN
EGANILRQEKCMLEVEAPITVCGDVHGQFFDLMKLFEVGGSPDNTRYLFLGDYVDRGYFS
IECVLFLWTLKINHSNTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMEAFDCLP
LAALLNQQFLCVHGGLSPEINCLDDIRKLDRFKEPPAFGPMCDLIWADPGEDYGSEKTAE
HFNHNSVRGCSYFFSYAAVCDFLTNNNLLSLIRAHEAQDAGYRMYRKSQTTGFPSLITIF
SAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLV
NVLNICSDDELMSEGDDLCEGGVPAVRKEVIRNKIRAIGKMARVFSVLREESESVLTLKG
LTPTGTLPLGVLSGGKQTLQNATIEAKEGQAIQGFSPTRKIRNFEEARGLDRINERMPPR
KDGQQPDSTTVNAANEKNGTDGNV
NT seq 1515 nt   +upstreamnt  +downstreamnt
atgatagtttccagtaagaacatctttgacaatgcacttcaaacagtgccactgccccct
caccagcggctgacaataaaggacctatttgtggatggtaagccaaatgccgagctactg
aagaaccatttgatcaaagagggacgtgtggaggaggacgttgcgctgcgcatcataaac
gagggtgccaacatcctaaggcaggagaagtgcatgctagaggtggaggcaccaatcact
gtatgtggtgatgttcacggacagttcttcgacctcatgaagctctttgaagttggtggt
tcccccgacaacacgcgctatctcttcctgggcgattatgtagaccgaggatacttcagt
attgagtgtgtgctgttcctgtggacattgaaaatcaaccattccaacaccctcttcctc
ctcagaggcaaccatgagtgtcggcacctcacagaatacttcaccttcaaacaggaatgt
aaaataaagtattcagagagggtttatgacgcatgtatggaagcctttgactgcttgcct
cttgcagctcttctaaaccagcagttcctctgtgtacacggtggcctctcaccagaaatc
aactgcttagatgacattaggaaattagaccggtttaaggagcccccggcatttgggcct
atgtgtgatttgatctgggccgacccaggagaggactacggcagtgagaagacggcagag
cactttaaccacaactcagtcagaggctgctcctatttcttcagttatgcagcagtttgt
gactttctgacaaacaacaacctgttgtcattaatcagagcacatgaagcacaagacgca
gggtacaggatgtacagaaaaagtcagacaacaggcttcccttcattaattaccattttc
tcagcaccaaattacctagatgtctataacaacaaagcggctgtattgaaatatgaaaac
aatgtcatgaacattagacagttcaactgctctcctcacccgtactggttacccaacttc
atggatgtgtttacgtggtcgctgccctttgtgggcgagaaagtgactgagatgttggtg
aatgtcctaaacatctgctctgatgatgagctcatgtcagagggagacgacttgtgtgaa
ggtggagttccagctgtccgtaaggaggtgatcagaaataagatccgtgccattgggaaa
atggccagagtcttttctgttctcagggaagagagtgagagtgtactgaccctcaaaggg
ctcaccccaaccggaacgctacctctaggagtgttgtctggaggcaagcagaccttacag
aatgccaccatagaagcaaaggagggtcaagccatccaaggcttctctcctacacggaaa
atccgcaacttcgaagaagctcgtggcctggaccgaataaacgaacggatgcctcctcgc
aaggacggccagcaacctgacagtaccacagttaacgctgccaatgagaaaaacggcact
gacgggaatgtgtaa

DBGET integrated database retrieval system