KEGG   Sinocyclocheilus grahami: 107553802Help
Entry
107553802         CDS       T04918                                 

Gene name
nit1
Definition
(RefSeq) nitrilase homolog 1 isoform X1
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
sgh  Sinocyclocheilus grahami
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    107553802 (nit1)
Enzymes [BR:sgh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     107553802 (nit1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-GeneID: 107553802
NCBI-ProteinID: XP_016091594
LinkDB All DBs
Position
Unknown
AA seq 310 aa AA seqDB search
MRLLAALRPLHALRSKAVRGQIRMSSSSSLPVAAVCQMTATPDKEANFSACMRLVEQAKE
GGACMVFLPEGLDYIGSNREETLQLSESLDGDIISRYSHLARKLDLWLSLGGFHERGHDW
KTDRRIYNSHIIINGQGELVSVYRKAHLFDVELTSKAVSLKESAFTVPGPRLVPPVQTPI
GKVGLGVCYDLRFPELSAALRRHGAEILTYPSAFTVATGAAHWEVLLRARAIETQCFVLA
AAQVGAHHAKRTSFGHALAVDPWGEVTGDCGGSDVGLTLVQIDLQRLRDIRRDMPVQQHR
RDQDFYCSLD
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctgcttgctgcactgagaccgctgcacgctttgagatcgaaggcagtgcgagga
cagatcaggatgtcgtcatcgtcatcacttcctgtggcggctgtttgtcagatgaccgcc
acccctgacaaagaggccaacttcagcgcttgcatgcgattggtggagcaggccaaagag
ggcggggcctgtatggtgttcctgccggagggcttggattacatcggctcgaaccgcgag
gagacgctgcagctgtccgagagtctggacggggacatcatcagccgttactcacacctg
gccaggaagctggacctgtggctgtctctgggtgggtttcatgagagaggacacgactgg
aaaacagaccggcgcatttataacagccatattatcatcaatggacaaggtgagctggtg
tctgtgtacaggaaggctcatttgtttgatgtggagctgacgagtaaagcagtgtctctg
aaagaaagcgctttcaccgtccccggacctcgactggtgcctcccgtccagacgcccatc
ggaaaggttggtcttggcgtctgctatgatctgcgttttcctgagctgtcagcagcgctg
cggagacacggagcagagatcctgacttacccatcagccttcactgtggccacaggagcg
gcacactgggaggtgctgctgcgggcgcgggccatcgagacgcagtgtttcgttctggcg
gcggcgcaggtcggggctcatcacgcgaagcggacgtcgttcggacacgcgctggctgtg
gacccgtggggtgaggtgaccggggactgtgggggttcagatgtgggtttaacactggtg
cagattgacctgcagagactacgggacatccggagggacatgccagtgcagcagcaccgc
agagaccaggacttctactgcagcctggactga

DBGET integrated database retrieval system