KEGG   Sinocyclocheilus grahami: 107553888
Entry
107553888         CDS       T04918                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B-like
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04012  ErbB signaling pathway
sgh04068  FoxO signaling pathway
sgh04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107553888
   04068 FoxO signaling pathway
    107553888
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107553888
SSDB
Motif
Pfam: CDI Rad50_zn_hook
Other DBs
NCBI-GeneID: 107553888
NCBI-ProteinID: XP_016091720
UniProt: A0A672NHL8
LinkDB
Position
Unknown
AA seq 183 aa
MSKVRVSNGSPTLERVDARQADHAKPPVCRNLFGSVDREELARDVKEQMLAMENASKEKW
NYDFDKNEPLAPGDYEWQEVDAKEVPEFYTRPPHAKRDTSAGTVDHNGTRDCLLTTSVQG
DSDNAEHGRRSDCRTTLTPPTKRPSTEDQDLPCQSKRANVQATEANCCPETSSHAPSKSD
PKT
NT seq 552 nt   +upstreamnt  +downstreamnt
atgtcaaaagtgcgcgtctccaatggaagtccgacgctggagagggtggacgcgaggcag
gcggatcacgccaaaccgccggtctgcagaaatctcttcggctccgtggatcgcgaagag
ctcgcgagggacgtcaaggagcaaatgctggcgatggagaacgcgtccaaggaaaaatgg
aattacgacttcgacaaaaacgagccgctcgcgcctggcgactacgagtggcaggaggtg
gacgcgaaagaggtgccggagttttacaccagaccgcctcacgcaaaacgggatacctcg
gccgggactgtggatcataacgggacccgcgactgtttgttgacaacgagcgtacagggg
gactctgacaacgcggagcacgggaggcgctcggattgccgaacgacgcttaccccgccg
acaaaaagaccgtcgacagaggatcaggatcttccttgccaaagcaaaagagccaacgtc
caagcgaccgaggcgaactgctgtccagagacgagttcgcacgcgcccagcaagtcggat
cccaaaacgtaa

DBGET integrated database retrieval system