KEGG   Sinocyclocheilus grahami: 107554263Help
Entry
107554263         CDS       T04918                                 

Gene name
esco1
Definition
(RefSeq) N-acetyltransferase ESCO1 isoform X1
  KO
K11268  N-acetyltransferase [EC:2.3.1.-]
Organism
sgh  Sinocyclocheilus grahami
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sgh03036]
    107554263 (esco1)
Enzymes [BR:sgh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-  
     107554263 (esco1)
Chromosome and associated proteins [BR:sgh03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Adherin complex
    107554263 (esco1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2_3
Motif
Other DBs
NCBI-GeneID: 107554263
NCBI-ProteinID: XP_016092214
LinkDB All DBs
Position
Unknown
AA seq 783 aa AA seqDB search
MPGQKRKMPSSEPEVKKTKIDQSLVESDKTQMPKKSLRGRPPKNKALETLSSKQRQQAQP
REENGKPVRRSSRLKTPQKKSSRGRRRKDEGKPKVSGDKKSQNMSVLKKGDKKYVSRVKK
EKPSISETIKTVAALFPVQIEHNYGRLLDLQSEEITLPKPDKIHVANISDLQSLHEPRVS
KVEEHKELPTDPIEKITVSVDAKVDVMSKSPPPLEALFKVIQETSITKHSFAGKDISDMD
ELEVVNTCSLQDSVQGTDMAKVFLPDAEAFLDDDIEIEHCVVEIETYEDLEEEDTVKKQT
GEAVTYKEVTSSPSLPQESATDSSQGLPKKQAMNPQARTKARLAALAEERAAATKKPQTR
QLNLLALCEEIADDIASDAPGTSDEKNIEQQQEASESTEVCETEKEASENAAPPETSSVE
TDDPKPEDGTPKKRFFLSQVSLPLKTQEKKKLSRYQRLRQVELQRDKLTWTRVKKLKSDQ
ASQAGSSKETDAPSVSPCPATTPAQVPVPESVPKVGSNEPRRALPAQAPPMPNGITSPKP
KPVVEYKAYTPRCKYSPDDFELDGLEEETSKPAAPKNEVKPEQSSSSAKVQPKPAVERKP
CVPTTADNKLKPSPQQEPDQKTQTENSNRENSSAEPGAEQKKEDKTSPKPASTAAQSGND
AGQKAFGAVTCNVCGMLYSPTSPEDESQHLLFHNQFISAVRYVGWKKERILGEYPDGKII
LVLPDDPKYALKKVEEIREMVDNDLGFQQVETKVPSQTKTFLFISNDKKVAGCLIAEHIQ
EVS
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atgcctgggcagaaaagaaagatgccttcttctgaacctgaagtgaagaaaacaaagata
gatcaaagtctcgtggagtcagataaaactcagatgcccaagaagtctttgagaggaaga
cctccaaaaaacaaagcgttggaaactctgtcgtctaagcagagacaacaagcacagccg
agggaagaaaatggaaaacctgttcgacggtcgtctcgcttgaaaacgccacaaaagaaa
agctcaagaggaaggcggcggaaagatgaggggaagccgaaagtctctggagataaaaaa
tctcaaaatatgtctgtcttgaagaaaggagacaagaaatatgtttcaagagtaaagaaa
gaaaagccatccatctctgaaacaattaaaacagtcgcagccttgtttcctgtgcaaata
gagcacaattatggacgattgcttgaccttcaaagtgaggagataacgttacccaaacct
gacaaaattcacgtggccaatataagcgatctgcagtcgcttcacgaaccgcgagtgagc
aaagtcgaagagcataaggagcttccgacagaccctattgagaaaatcacagtgagtgtg
gatgcaaaagtagatgtgatgagcaaatctcctccacctctagaggcgcttttcaaagtc
atccaagaaaccagcatcacgaaacactccttcgccggtaaagacatttccgacatggat
gagttagaagttgtgaacacgtgttccctgcaggacagcgtacaaggtaccgacatggca
aaagtgtttctcccggatgcagaagcatttctggatgacgatattgagattgaacattgt
gtggtggagatcgaaacttatgaggatttggaggaggaggacaccgtgaaaaagcaaaca
ggtgaagctgtgacgtataaggaggtcacttcttcgccctctttgccccaggaaagtgcg
acggactcctcgcaagggcttcctaaaaagcaggccatgaacccgcaggctcggacgaag
gcacgtctggcggctttagctgaagaaagggcggctgccactaagaaaccccaaactcga
cagctcaacctgcttgctctctgtgaagaaatcgcagatgatattgcatccgatgctccg
ggaacttcagatgagaaaaatattgagcaacaacaggaggcgagtgaatcaacggaggtt
tgcgaaaccgaaaaagaggcgtctgaaaacgccgcaccccccgaaacttctagtgttgag
actgatgatcccaaacctgaggatggtacgcccaagaaacgttttttcctcagccaggtg
tctttgccgctcaagacccaggagaagaagaaactctcccgctatcagaggctcaggcag
gtggagcttcagcgggataagttgacttggacccgtgttaagaagctgaagtcggatcag
gcgagtcaggctggttcttccaaggagactgacgctccatcggtctcaccctgcccggcc
accacccctgcacaggttcctgtgccagaaagcgtgcccaaagtaggctccaatgaaccc
aggagggcacttccggctcaggcgccacccatgcctaatggaatcaccagccccaaaccc
aaaccagttgtggaatataaagcctacactcccagatgcaagtattcaccagatgacttt
gagcttgatggtcttgaagaggagacgagcaaaccagcagcacccaaaaatgaggtcaaa
ccagagcagtcctcttcatcagctaaagtgcagcccaaaccagcagtggagagaaagcca
tgcgtccccactactgcagataataagctgaaaccctctccccagcaagaacctgaccaa
aagacgcagacagaaaacagcaaccgggaaaattctagtgctgaacctggagcagaacag
aagaaagaggacaaaaccagtcccaaacctgccagtacagcagcacagtccggcaatgat
gctggtcagaaggcgtttggtgcggtgacgtgtaacgtgtgtgggatgctgtactctcct
accagcccagaggacgaatcccaacacctcctcttccacaaccagttcatcagcgctgtc
agatatgtgggctggaagaaggagagaatcttgggagagtatcctgatggcaagattatt
cttgttctccctgatgatcctaagtacgcacttaaaaaggttgaggagatcagagaaatg
gtggacaatgacttgggcttccagcaagtggagaccaaagtcccatcacagaccaaaacc
ttcctcttcatttcaaatgataagaaagtcgcaggctgtctaatcgcagagcacatacaa
gaggtcagctga

DBGET integrated database retrieval system