KEGG   Sinocyclocheilus grahami: 107554512Help
Entry
107554512         CDS       T04918                                 

Definition
(RefSeq) N-lysine methyltransferase SETD8-A-like
  KO
K11428  histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:sgh00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    107554512
Enzymes [BR:sgh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     107554512
Chromosome and associated proteins [BR:sgh03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107554512
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 107554512
NCBI-ProteinID: XP_016092518
LinkDB All DBs
Position
Unknown
AA seq 323 aa AA seqDB search
MCFVIKLKPVGASFLNLTVLQDVICNGRSPFHRLLQRSSSKSQHHEAISVKLIQDGKTSQ
LFCMQNEPQKNGDSRRGSTVNGEFILPKMAVNEELVHRAEEQTHQLHCTASYIHASSAVT
SPSQRKRACRTVKVKTSTKRITDTKSTQSRKVTDYYPIRRSSRKSKSELKCEEKRHIDML
ITNGIENGMMVRYIEGKGRGVFVTQKFQKGQYVVEYHGDLLQITDAKKREALYTQDPTTG
CYMYYFQYLSKTYCVDATKESDRLGRLINHSKNGNCQTKLHDINGIPHLILVASRDIQKG
EELLYDYGDRSKASIEAHPWLKH
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtgctttgtcataaaactcaagccagttggcgcctcctttctaaatctcactgttttg
caggacgtcatatgcaacggacgctcgccatttcaccgtctcttacagcgcagcagctcc
aaatcgcagcatcatgaagccatctccgtcaaactcatccaggacggcaaaacttctcaa
ttattctgcatgcaaaatgagccacagaagaatggagattccaggagaggtagtactgta
aatggtgagttcatcctcccaaaaatggctgtgaatgaagagctggtgcacagagccgag
gagcagacgcatcagctgcactgcactgcatcatacatccacgccagcagtgccgtcact
tcccccagtcagaggaaacgagcctgtcgaacagttaaagtaaagacatctacaaagaga
attactgataccaagagcactcaaagccgaaaggttacagattattaccccatcagaaga
agctctagaaaaagcaaaagtgaactgaagtgtgaagagaagaggcacatagacatgctg
atcacaaacgggattgagaatggaatgatggtcagatacattgaaggaaagggcagggga
gttttcgtcacacagaagttccagaaaggccagtatgtagtggagtatcatggagatctg
ctgcagataacggacgccaaaaaaagggaggctttatacacacaagatccaaccactggc
tgctacatgtattactttcagtatctcagcaaaacatattgtgtggacgctacgaaggag
tcggatcgattgggaaggctcattaaccacagtaaaaacggcaattgtcaaaccaaactc
cacgatattaatggaatacctcaccttatcctcgtggcctccagagacatccagaaagga
gaagaacttctttacgactacggtgaccgcagtaaagcttcgatagaagctcacccgtgg
ctgaagcattaa

DBGET integrated database retrieval system