KEGG   Sinocyclocheilus grahami: 107554639Help
Entry
107554639         CDS       T04918                                 

Gene name
acp2
Definition
(RefSeq) lysosomal acid phosphatase
  KO
K14410  lysosomal acid phosphatase [EC:3.1.3.2]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh00740  Riboflavin metabolism
sgh01100  Metabolic pathways
sgh04142  Lysosome
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    107554639 (acp2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    107554639 (acp2)
Enzymes [BR:sgh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.2  acid phosphatase
     107554639 (acp2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 DUF5527 Sarcoglycan_2
Motif
Other DBs
NCBI-GeneID: 107554639
NCBI-ProteinID: XP_016092699
LinkDB All DBs
Position
Unknown
AA seq 415 aa AA seqDB search
MESCFLIVAFLVAFSLSDGERTLKFVTVLYRHGDRSPIKAYPTDPYKESDWPQGFGQLSQ
EGMKQHFELGQFLKKRYTGFLSEDYDRHEIFIRSTDVDRTLMSAEANLAGMFPPNGSEVF
NPDLKWQPIPIHTVPADEERLLSFPLEDCPRYTQLMNETEKTGIFLNMTETYKGLIEMVR
NKTGLEKANIETIWSLYDTLFCEAKHGMRPPDWVTSSVMEALKVLKNFGFQILFGVYKRK
EKCRLQGGLLLDQIIKNLSNAAAPNSKQEVKMMVYSAHDTTIVALQEALDVFNGLQPPYA
SCHLIELHQEENGLFTVQMFYRNDTNVSEPYPVSLPGCSQRCPLQDFVNLTREVIPQDRN
KECQIRKEATDTEVIIGLAVCGCLLFLLVLLLFVVLCRLKEPVASYSHVINESDS
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggagtcctgttttctgatcgtcgctttcctcgtcgctttcagtctttccgatggagag
aggacgctgaagtttgtcactgtgctttatcgtcatggtgacagatctccaatcaaggcc
tatccaactgatccctataaggagagtgactggccccagggttttggacagctctctcag
gagggaatgaagcagcacttcgagctgggtcagtttttaaagaaacgctacacaggattc
ctgagtgaggactatgaccggcatgagatattcatcagaagtacagatgttgaccggact
ctaatgagtgcagaagcaaacctggctggcatgttcccacctaatggttctgaggtgttt
aatccagatttgaaatggcaaccaatacctattcacactgtcccagcggatgaagagagg
ctgctctcattccctctggaagattgtccacgttacacacaattaatgaatgagactgaa
aaaacaggcatttttcttaacatgactgaaacctacaagggcttaatagagatggtgaga
aataaaacaggactggagaaagccaacattgagactatttggagtttgtatgacacattg
ttctgtgaggcaaaacatgggatgcgaccacctgattgggttacgtcaagtgtgatggag
gcgctaaaggtgttaaagaactttggttttcagattctgtttggagtgtacaagagaaag
gagaagtgcagacttcagggaggcctgctgttagatcagatcattaagaatctctcaaat
gcagcagcaccaaactctaaacaggaagtgaagatgatggtatactcagctcatgacaca
acaattgtagccctgcaggaagctctggatgtctttaatggcctgcagccaccttatgcc
tcatgtcatctaattgaacttcaccaggaagagaacgggctgtttacagtgcagatgttt
tatcgcaatgacactaatgtgtctgagccgtaccctgtgtctttaccgggctgttcccag
cgttgtcccctacaggactttgtgaacctcacacgtgaagtcataccacaagacaggaat
aaagagtgtcagataaggaaggaagccacagacactgaggtcatcatcgggctggctgtg
tgtggatgtcttctcttcctcctggtactgctgctgtttgtagtgctatgccgtctaaaa
gagcccgtggctagctacagtcatgtcataaacgagagtgactcctga

DBGET integrated database retrieval system