KEGG   Sinocyclocheilus grahami: 107554687
Entry
107554687         CDS       T04918                                 

Gene name
nr3c1
Definition
(RefSeq) glucocorticoid receptor
  KO
K05771  glucocorticoid receptor
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107554687 (nr3c1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sgh03000]
    107554687 (nr3c1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:sgh03310]
    107554687 (nr3c1)
Transcription factors [BR:sgh03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    107554687 (nr3c1)
Nuclear receptors [BR:sgh03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   107554687 (nr3c1)
SSDB
Motif
Pfam: Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 107554687
NCBI-ProteinID: XP_016092758
LinkDB
Position
Unknown
AA seq 391 aa
MFAPSIGATANLQLEGSTATSSAAGKSGTHKSCLVCSDEASGCHYGVLTCGSCKVFFKRA
VEGQHNYLCAGRNDCIIDKIRRKNCPACRYRKCLMAGMNLEARKTKRGRQTGKVIQQPSI
PERSLPPLLEVQALVPKPMPQVVPTMLSLLKAIEPDTIYAGYDSTIPDTSTRLMTTLNRL
GGRQVISAVKWAKALPGFRNLHLDDQMTLLQCSWLFLMSFGLGWRSYQQCNGNMLCFAPD
LVINEERMRLPYMTDQCEQMLKISNEFVRLQVSNEEYLCMKVLLLLSTVPKDGLKSQSVF
EELRMSYIKELGKAIVKREENSSKNWQRFYQLTKLLDSMHDMVGGLLNFCFYTFVNKSLS
VEFPEMLAEIISNQLPKFKAGSVKSLLFHQK
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgtttgcaccttcaattggtgcaacagctaacttacaacttgaaggcagcactgccaca
tcctcagctgctgggaagtccggcacacacaagagctgtcttgtgtgctccgatgaagct
tcaggctgccattatggagtcctcacctgcggaagctgtaaagtcttctttaagagagca
gttgaagggcaacacaattacctgtgcgctggacggaacgattgcatcattgacaaaatc
cgccggaagaactgccctgcctgtcgttaccgcaaatgcctcatggcaggcatgaaccta
gaggcccgtaaaaccaagaggggccgtcaaactggcaaggtaatccagcagccgtcgatt
ccagagcgcagtcttcctccgctgctcgaagtccaggcattggtgcccaaacccatgcct
caggtggtgcccaccatgctgtcactgctaaaggccatcgagccggacaccatctacgcc
ggatacgacagcaccatccctgacacctccacccgcctcatgaccactctgaaccggctg
ggcggccggcaggtcatctctgcggtcaaatgggccaaagctctgccagggttccggaac
cttcacctggatgatcagatgaccctcctgcagtgttcctggctgttcctcatgtccttc
ggactcggttggaggtcataccagcagtgcaatggaaacatgctgtgtttcgcaccagac
ctggtcatcaatgaagaaaggatgaggttgccctacatgactgatcagtgtgaacagatg
ctgaagatctccaatgagtttgtgagactgcaagtgtccaacgaggagtacctgtgcatg
aaagtccttctgctcctgagcacagtgccgaaggatggtttgaagagccaatcagtgttt
gaggagctacggatgtcttacattaaagaactgggcaaagccattgtgaagagagaggag
aactccagcaagaactggcaacgattctatcagctaactaagctactggactccatgcac
gacatggtgggtggactcctgaacttctgtttctacacctttgtgaataaatccctcagc
gtggagtttcccgaaatgctggcggagatcatcagcaaccagttaccaaaattcaaagct
gggagtgtcaaatcgctgctgtttcaccagaagtga

DBGET integrated database retrieval system