KEGG   Sinocyclocheilus grahami: 107554712
Entry
107554712         CDS       T04918                                 

Definition
(RefSeq) putative fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107554712
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107554712
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sgh04052]
    107554712
   00536 Glycosaminoglycan binding proteins [BR:sgh00536]
    107554712
Cytokines and growth factors [BR:sgh04052]
 Growth factors
  Growth factors (RTK binding)
   107554712
Glycosaminoglycan binding proteins [BR:sgh00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   107554712
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 107554712
NCBI-ProteinID: XP_016092788
UniProt: A0A672RI61
LinkDB
Position
Unknown
AA seq 147 aa
MTEADPAAKRGPPDYKKLARLYCMNGGFHLRLAADGTVEGAREEDDYSILRIKATSPGVV
VIEGAETGLYLSMNEDGKPYASSLVTDESYFLERMEENHYNTYQSQKHGENWYVGIKKNG
RMKRGPRTHIGQKAIFFLPRQVDQTKD
NT seq 444 nt   +upstreamnt  +downstreamnt
atgacggaggccgatcctgcggcgaaacgcggccctcccgactacaagaagctggcgcgg
ctgtactgcatgaacggaggatttcacctgcggctcgcggcggacggaaccgtggaggga
gcgcgagaggaagacgattacagcatactgcgcataaaagctactagtccaggagtggtg
gtcattgaaggagcagagacaggactttacctctctatgaatgaagacggcaagccgtac
gcttcatcattagtaacagatgaaagttatttcttggagaggatggaggaaaaccactac
aacacgtatcagtctcaaaagcacggtgaaaactggtacgtcgggataaaaaagaacgga
agaatgaaacgcggtccaagaacacacattggacaaaaggcgatcttctttctccctcga
caggtggaccagacaaaggactga

DBGET integrated database retrieval system