KEGG   Sinocyclocheilus grahami: 107554778Help
Entry
107554778         CDS       T04918                                 

Definition
(RefSeq) dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial-like
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh00020  Citrate cycle (TCA cycle)
sgh00310  Lysine degradation
sgh00380  Tryptophan metabolism
sgh01100  Metabolic pathways
sgh01200  Carbon metabolism
Module
sgh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sgh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sgh_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    107554778
  09105 Amino acid metabolism
   00310 Lysine degradation
    107554778
   00380 Tryptophan metabolism
    107554778
Enzymes [BR:sgh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     107554778
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 HlyD_D23 GCV_H DUF4093
Motif
Other DBs
NCBI-GeneID: 107554778
NCBI-ProteinID: XP_016092872
LinkDB All DBs
Position
Unknown
AA seq 378 aa AA seqDB search
SSAIAGNEVITVKTPAFAESVTEGDVRWEKAVGDTVSEDEVVCEIETDKTSVQVPSPAAG
VIEELLVPDGGKVEGGTPLFKLKKGAGAAKTTAAPPPAAETAPPPPAAAPAPAAAPAAGG
PIPTSMPPVPPVPAQPIQSKPVSAIKPTAAPAAAADAGAKAARSEHRVKMNRMRQRIAQR
LKEAQTTCAMLTTFNEVDMRFVPVKANQPTPDYTVTGSLKCVFNTLPVKGWCSPSTQFCY
QDLLHLGFLICAVIDDTTKEIVYRDYVDISVAVATPKGLVVPVIRGVEGMNFTDIEKAIN
ELGEKARKNELAVEDMDGGTFTISNGGVFGSMFGTPIINPPQSAILGMHGIFERPVAIAG
KVRWERLGVFCALCQSSL
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
tcttctgcgattgcagggaatgaagttattacagtgaaaacaccagcgtttgccgagtct
gtcacagagggagacgtcaggtgggagaaagctgttggagacacagtctctgaagatgag
gtcgtctgtgaaattgagaccgataagacgtcggtgcaggttccctctccagctgcagga
gtcatcgaggagctgctggttcctgacggaggcaaagtggaaggaggaactcctctgttc
aaactcaagaaaggagctggagcggctaagacgacagcagcacctcctcctgcagcagag
actgctcctcctccccctgctgctgctcctgctcctgctgctgctcctgctgctggaggg
cccatccccaccagcatgccccctgtaccccctgtgccggcccagcccatccagtccaaa
ccagtttctgccatcaaacccactgcagctcctgctgctgctgctgacgccggagccaaa
gccgctcgatcagagcacagggtgaagatgaaccgcatgagacagcgaatcgctcagcgg
ctgaaggaagcgcagaccacctgtgccatgctcacaaccttcaatgaagtcgatatgagg
tttgttcctgtaaaagcaaaccagcctactccagattatacagtcactggttctttgaaa
tgtgtttttaataccctgccagtcaaaggttggtgctcacctagtacacagttttgttat
caggatcttctacatctcggatttttaatctgcgcagtcattgatgacacaaccaaagag
atcgtgtatcgggattatgtggatatcagtgtggcagtcgcgaccccgaaggggctcgtg
gttcccgtgatcagaggcgtggagggaatgaacttcacagacatcgagaaagcgattaac
gagctgggagagaaggctcgtaagaacgagctggctgtggaggacatggacggcggcacc
ttcaccatcagcaacggaggagtgttcggctccatgttcgggactcccatcatcaacccg
ccgcagtcggctattctgggcatgcatggcatctttgagcgtcccgtggccatcgctggg
aaggttagatgggaacggcttggtgttttctgtgccttgtgtcagtcgagtctttaa

DBGET integrated database retrieval system