KEGG   Sinocyclocheilus grahami: 107555186Help
Entry
107555186         CDS       T04918                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn]-like
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    107555186
Enzymes [BR:sgh01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     107555186
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu CHRD
Motif
Other DBs
NCBI-GeneID: 107555186
NCBI-ProteinID: XP_016093390
LinkDB All DBs
Position
Unknown
AA seq 154 aa AA seqDB search
MAMKAVCVLKGTGEVTGTVYFEQQNETSSVKLSGEITGLTPGKHGFHVHAFGDNTNGCIS
AGPHFNPYGKNHGGPTDSDRHVGDLGNVIADDNGVAKIGIEDKIATLLGQHSIIGRTMVI
HEKEDDLGKGGSEESLKTGNAGGRLACGIIGITQ
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgaaagctgtttgtgtgctcaaaggcaccggggaagtgaccggaaccgtttat
ttcgagcagcagaacgaaacgtcttcagtgaagctctcaggtgaaatcactggccttact
ccaggaaagcatggtttccatgtccatgcttttggagacaacacaaatggctgcatcagt
gcaggtccacacttcaacccttatggtaaaaatcatggtggaccaactgatagtgacaga
catgtcggagaccttggtaacgtgatagccgatgacaatggtgttgcaaaaattggcatt
gaggataaaattgcgaccctgttagggcaacactccatcattgggaggaccatggtgatc
catgagaaggaggatgacttgggtaaaggaggcagtgaagaaagtcttaaaactggcaat
gctggaggtcgcctggcctgtggaattataggcatcactcagtga

DBGET integrated database retrieval system