KEGG   Sinocyclocheilus grahami: 107556481Help
Entry
107556481         CDS       T04918                                 

Definition
(RefSeq) PR domain zinc finger protein 2-like isoform X1
  KO
K11432  histone-lysine N-methyltransferase PRDM2 [EC:2.1.1.43]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107556481
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sgh03036]
    107556481
Enzymes [BR:sgh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     107556481
Chromosome and associated proteins [BR:sgh03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107556481
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2_4 zf-C2H2 zf-C2H2_6 zf-C2HE zf-C2H2_11
Motif
Other DBs
NCBI-GeneID: 107556481
NCBI-ProteinID: XP_016095095
LinkDB All DBs
Position
Unknown
AA seq 1493 aa AA seqDB search
MTACSYVSVVEEERLSMPSEAFLQQPEVQDAHSDETALHSISEPEGEEIEKGTEGGTDVK
MDCKDKQNASQPVSQNLANQNQTCQTSETEHVGMIKQDYGTEWPLNGTKGDLGPGSKPQR
DLLCPRCERRFASSQGLQRHIQTHALSTCHTQRFKCSRCRRSFSTLFSRRRHEKRHESRN
RKTDDLTDAPCTASQNVHGSAEPLKAASQNPEPNKRINNAADGEQNDDRNSDIKASHVCK
YCKKAFRTHTNLRRHQRRIHERHLLPRGVYKKVKIIQEPDGQQLAETAQDNHTANSQCVE
DIDQEREYMVDISSNISENLSFYIDGKIVSTSAISNCEVIEMNSGGSAVIGLNAVIISPA
QISQALKLETNTSSFTSDLSGQSSTRRRTSTPPLLPQIKTELESESILSTSSSSLSSLTL
SSTSGAPLVTAHLPQCIETVAFNKEKTVYLSPKLKQILQNQDGSKPAFALIADGPKLGPP
LSLTVLSATTTRFKRRTTSPPSSPQQTPDVNIEKQDQDSTKAKKSKLESYGLGNEPEPLN
SPINSSDGAPMQQQILPLDCSVSRTGGNSCNQQPLDLSNSVVKRESSDALAESILDLSIS
GKSLDCNSAGVYLTQPVLRKSKPNSSMLQKVLMNEYGEVDVPSVDAPAAAGVLSVPDITN
VAVVAVSDAGPPKPENVLFELVLPPASINPTPSLLAPVSIHPATPVPPPQCSPSSSPTFV
SFLSTPTVEPSQDIQSLHSAFVVSENIAPTGSVEDCTDNPVHLSQGDMKVTIPDWGSSAP
GGLENLIPVVPSLSLQSPHWVADPAVCELAQRTLVVDSVLASDAQIFSPSLPVNQSNVTS
LAFPPNTVVIEYTVAVKSTENILPALQHNSLPCLSNKIPVDALQQEPHVSPEPQPLSPDT
TLLPETSTQSAPTEQSTSSTDRKLTLTASASVVEAESNENGLENVQSSDCSKQENKVEEE
LPPLHPFCKNFMCNVCEQPFQSMKILSQHVGEHSKGWPYKCEFCVQLFESDTGLLEHRSS
YHGIGKIYVCKTCSKEFAFLCNLEQHQRDLHPGQECSHSEAVHGKLRPENHNDPKTDMAD
PGLPVTEIKQEIDNTTSKADKDSLDNTSEELFTTIKIMASGGVKSKGPDVRLGINQHYPS
FKPPPFPYHNRTPTGTTAASATNFTTHNIPQTFSTAIHCTKCGKSFDNMPELHKHILACA
SANDKKRYTPKKNPIPLKQFAKAQNGVLSPARIVNSKQNFSQKVGQPKKLNWIKMSILNK
KKSQLVQRGRPAGGRKAFAQDDLGVFACPHCRREFTYNASLKKHVAFSCPMRPASRNSKK
RTLSIVSAQENNGSLRRQIANMSAKPQGSGHGPKTITKNQIIKQKAAVDTTQDFRLKRST
ILSTSVVQSSKKGKPVELKSGFMPQLASKQIVLSSVSQEPGVRVHVLSRKMEQRVGDIKI
QPRREDRLSLRLRERVGGPITRSVQQASTTTTALKQPDSHNIIMHPVVLQVKK
NT seq 4482 nt NT seq  +upstreamnt  +downstreamnt
atgacagcatgttcatatgtttcagttgtagaagaggagaggcttagtatgccatcagag
gcttttctccagcaacccgaggttcaagatgcccactctgatgaaactgcacttcatagc
atctcggagccagaaggggaagagatagaaaaagggacagaaggaggaacagatgtgaag
atggactgcaaagacaaacagaatgcaagccagcctgtgtcacaaaatctagctaatcaa
aatcaaacctgtcagacaagtgagactgagcatgttggaatgataaaacaggattatggt
actgagtggcctttaaatggcactaagggtgaccttggccctggtagtaaaccccagcgt
gatttactctgtcctcgctgtgagagaaggtttgcgagtagtcaaggcctgcagcgtcac
atacaaacacatgccctttcaacctgccacacacagcgttttaaatgcagtcgttgcaga
aggagtttcagtacattgtttagtcgtcggaggcatgagaaaagacatgaaagtagaaac
aggaagacggatgatctcacagatgccccttgcactgccagtcagaatgtgcatggcagt
gctgaacctctgaaagcagcatcacagaacccagagccaaacaagcgcattaataatgca
gctgatggtgaacaaaatgatgatagaaacagtgatatcaaagcctcacatgtctgcaag
tactgcaaaaaagcatttaggactcatactaatttaaggagacatcaacgcaggatccat
gagcgccatcttcttcctagaggagtttataagaaggtcaaaatcattcaagaacctgat
ggacagcagcttgctgagacggcacaggacaaccatactgctaattcacagtgtgtagag
gacattgatcaggaaagggagtacatggttgacatctccagtaacatttcagagaatctc
agcttttacatagatgggaaaattgtctcgacaagtgctataagtaactgtgaggtgatt
gagatgaactctggtggctctgctgttattggattaaatgctgttataatcagtccagct
caaatttcacaagctcttaaattagaaactaataccagtagttttacctctgacttgtct
gggcagtcctcaaccagacgtaggacgtctaccccacctttactcccacaaataaaaaca
gaattagagtctgaatccatcttgagtacctcctcatcttccttgtcatccttgacactg
tcctctacatctggagctccgctagtcactgctcatttacctcagtgcattgagacagtt
gcctttaacaaggaaaaaactgtctatctgtctcccaaactcaagcagatccttcagaat
caggatggcagtaaaccggcatttgcactgattgctgatggcccaaaactgggtcctccc
ttatccctgactgttttatctgcaacaacaactagatttaagagaaggacaacctcccct
cccagctcaccacagcaaacccctgatgtgaatatagaaaagcaagatcaggattctaca
aaagcaaagaagtcaaagttggagagctacgggttgggcaatgaacctgagcctttgaat
tcacccataaacagctctgatggagctccaatgcagcaacagatcttgccattggactgc
tctgtatcaagaacaggtggaaactcctgcaatcagcagccactggacctctcaaattcc
gtggttaagcgagagagcagcgatgccttagcagagtccattctggacttaagtattagt
ggaaagagtttagattgtaactcagctggagtctatctcactcaacctgttttaaggaag
agtaaacctaactctagtatgcttcagaaggtgctaatgaatgagtatggtgaggtagat
gttccttctgttgacgctccagctgctgcaggtgtcctcagtgtccctgacataacaaac
gttgcagttgtggcagtgtctgatgcaggtccaccaaaacctgaaaatgttttgtttgag
ttggttcttcctcctgcttcaatcaatccaaccccttcactgctcgctccagtcagcatc
catccagctaccccagtccctccacctcaatgttcaccttcttcatctccaacttttgta
tcctttctatcgactcccacagtggaacccagtcaggacattcaaagtcttcattcagcc
tttgtggtatctgaaaatatagcacccacagggtctgtagaagactgcactgataatcct
gtacatctttcacagggtgatatgaaagtgacaatccctgactgggggtcctctgctcct
ggaggtctggaaaaccttatacctgtagtcccttcactgagtttacaaagccctcactgg
gttgctgatcctgctgtatgtgaactagctcaaagaacattggttgtagactctgtatta
gcttctgatgcacagatattttctccatctctgcctgttaaccagtccaacgtcacatcc
ttggcttttcctccaaacactgttgttattgagtatacagttgcagtgaaatctacagaa
aatattcttccagctctccaacataattctcttccatgtctctcaaataaaattcctgtc
gatgcattacagcaagaacctcatgtctcacctgagccacaacctctcagtcctgatacc
accctattgcctgaaacctccacacagtcggcaccaacagagcagtcaacaagctcaaca
gatcgtaaactgaccctcactgcttccgccagtgttgttgaagcagagagcaatgagaat
ggactggaaaatgtccagtcctctgattgttctaagcaggaaaacaaagttgaagaagag
ttacctcccttgcatcctttttgcaagaacttcatgtgcaatgtttgtgaacagcccttc
cagtccatgaagattcttagtcaacatgtaggtgagcactccaaagggtggccctataaa
tgtgaattttgtgtgcagttgtttgagagtgacacaggtttgctggagcaccgttccagt
tatcatggcattggtaaaatttatgtttgtaaaacatgttctaaggaatttgcttttctc
tgcaacttggaacagcatcagcgagatctccatcctggtcaagagtgctcacacagcgaa
gcagtacatggcaagttaaggcctgaaaaccataacgatcccaaaaccgacatggctgac
ccaggccttccagtcacagaaattaagcaagaaattgacaacacaacctcaaaagcagac
aaggattccttggacaacacttctgaggaactgttcacaacaattaaaatcatggcatct
ggaggggtcaaatcaaaaggcccagatgtacgattaggcattaaccaacattacccaagt
ttcaaaccgcctccttttccataccacaatcggacaccaactggaacgacggcagcatcg
gccaccaacttcaccacccacaacatccctcagaccttcagcacagccattcattgcacc
aaatgtggtaagagctttgacaacatgcctgaactgcacaagcacatcttagcttgtgct
agtgctaacgacaagaagcgatacactcctaaaaagaaccctataccacttaagcagttt
gcaaaagcgcaaaatggggtgttatcacctgcaaggattgttaatagtaagcagaatttc
tcgcaaaaggtcggccaaccaaaaaaactgaactggataaaaatgagtatcctgaataag
aagaaatctcagctggtgcaaaggggcagacctgctgggggaagaaaggcctttgctcag
gatgacctgggcgtttttgcatgtcctcactgtaggagagagtttacatacaatgctagt
ttaaagaaacacgtagcttttagctgtcccatgagaccggccagtagaaactccaaaaaa
agaacactcagcattgtttcagcccaggagaacaacgggagccttcgcagacaaattgca
aatatgagcgcaaagccacaaggttcaggccacgggccaaaaacaataacaaagaatcag
atcattaagcaaaaagcagcagttgataccactcaggattttaggcttaaaagatctacc
attctgtcaacatctgtggttcaatctagtaaaaaaggcaagcctgtggagctaaagagc
ggctttatgccacagctggcttcaaagcagatagtcctctcatctgtctctcaggagcca
ggtgttcgggtacatgttttaagtagaaaaatggagcagagagtgggtgacataaagata
cagcccagaagagaagaccgtttgtctctgaggttgagagagagagtaggaggacctatt
actcgcagtgtgcagcaggccagcaccacaacaacagcccttaaacagccagacagtcac
aacattatcatgcaccctgttgttctccaagtcaagaaatga

DBGET integrated database retrieval system