KEGG   Sinocyclocheilus grahami: 107557004
Entry
107557004         CDS       T04918                                 

Definition
(RefSeq) transcription factor GATA-4-like
  KO
K09183  GATA-binding protein 4
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04218  Cellular senescence
sgh04530  Tight junction
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    107557004
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107557004
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sgh03000]
    107557004
Transcription factors [BR:sgh03000]
 Eukaryotic type
  Zinc finger
   Cys4 GATA-factors
    107557004
SSDB
Motif
Pfam: GATA-N GATA TF_Zn_Ribbon Zn-ribbon_8 ArfGap Zn_Tnp_IS1595 Prim_Zn_Ribbon
Other DBs
NCBI-GeneID: 107557004
NCBI-ProteinID: XP_016095771
UniProt: A0A672KB15
LinkDB
Position
Unknown
AA seq 373 aa
MDMYQGVTMTTNHGPASYEPGFLHNAASPVYVTPTRVTPMIPALPYLQTPQQSSPVSGHS
GWAQPGADTVASYSSTGGHHHSPVSRFTFSTSPPLTSGVATARETASYTSPLNISAGGRE
HYGTRGLSGSYHSGYPAYVSPNIGGSWTASHFDSSVLHGLQSGGAAGAARHPNLELLEDF
SEGRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPIIKPQRRLSASRRVGLSC
TNCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMKKEGIQTRKRKPKNISKSKPG
SSEGQTQASPTDEPRPIKTEPDTASIYTHHNMNTPVSAFPSYMGTPSSSSALKLSPSGSS
SSKSEVWNSLILA
NT seq 1122 nt   +upstreamnt  +downstreamnt
atggacatgtatcaaggcgtaacgatgaccacgaaccacggacccgcgtcttacgagccc
ggtttcctccataacgccgcttcgccggtgtacgtgacgcccactcgggtcaccccgatg
atcccggcgctgccgtacctccagacgccgcagcagagcagcccggtgtccggacactcg
ggatgggcgcagccgggcgcggatacggtcgcttcttacagctccaccggcgggcaccat
cattctccggtctccaggttcacgttctccacgagccctccgttaacctccggggtcgcg
acggcccgagagactgcgagttacacgagtccgctgaacatctccgctggcgggcgggag
cactacgggacccgcggtctgagcggatcctatcacagcgggtacccggcctacgtgagt
ccgaacatcggaggctcttggacggcgtcgcacttcgacagctccgtgctgcacggcctc
cagagcggaggagcggccggtgccgcgcgacacccgaatttagagctgctggaggatttc
tctgagggtcgtgagtgtgtgaactgcggggcgatgtccactcctctgtggcggcgggac
gggacgggtcattacctgtgtaacgcctgcggtctctaccacaagatgaacgggatcaac
cggccgatcattaaaccgcagagacgactgtctgcgtccagacgggttggtttgtcctgc
actaactgtcagacgaccacaaccactctctggagacgtaatgcagaaggagagccggtc
tgcaacgcctgcggactctacatgaaactccacggggttcctcgtcctctggccatgaag
aaagagggaattcagacccgcaaacgcaaaccaaaaaatatcagcaagtccaaacctggg
tcatctgagggtcagacgcaggccagtcccacagatgagccgcggcccataaagacggag
ccagacacggcgtcaatctacacacaccacaacatgaacacaccggtctctgcctttccg
tcttatatgggaactccgagctcaagttctgctctcaaactttctccaagtggatcttcc
agctccaaaagtgaagtgtggaacagcctgattctggcataa

KEGG   Sinocyclocheilus grahami: 107564601
Entry
107564601         CDS       T04918                                 

Definition
(RefSeq) transcription factor GATA-4-like
  KO
K09183  GATA-binding protein 4
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04218  Cellular senescence
sgh04530  Tight junction
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    107564601
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107564601
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sgh03000]
    107564601
Transcription factors [BR:sgh03000]
 Eukaryotic type
  Zinc finger
   Cys4 GATA-factors
    107564601
SSDB
Motif
Pfam: GATA-N GATA TF_Zn_Ribbon Zn-ribbon_8 ArfGap zf-C4pol
Other DBs
NCBI-GeneID: 107564601
NCBI-ProteinID: XP_016105204
UniProt: A0A672KRJ0
LinkDB
Position
Unknown
AA seq 379 aa
MYQGVAMTANHGPASYEPGFLHNAAASPVYVTPTRVTPMIPALPYLQTPQLSSPVSAHSG
WAQAGADTVASYNCTGGQHHSPVSRFTFSTSPPLSSGVAVARETANYSSPLNISAGGREH
YGSRGLSGSYHRGYPDYLSPNIGGSWAASHFDSSVLHSLQSGGAPGATRHHNLELLEDFS
EDRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNRINRPLIKPQRRLSASRRVGLSCT
NCQTTTTTLWRRNAEAEPVCNACGLYMKLHGVPRPLAMKKEGIQTRKRKPKNISKSKPGS
SEGQTVSSAMNSSPTEEPRPIKTEPDTASLYTHHNTSMNTPVSVFLSYMGTPSSSSALKL
SPSGSSSSKSEVWNSLILA
NT seq 1140 nt   +upstreamnt  +downstreamnt
atgtatcaaggtgtagcgatgaccgctaaccacggacccgcgtcttacgagcccggtttc
ctccataacgccgccgcttcgccggtgtacgtgacgcccacccgggtcaccccgatgatc
ccggcgctgccgtacctccagacgccgcagctgagcagcccggtgtccgcgcactcggga
tgggcgcaggcgggcgcggacacggtcgcctcttacaactgcaccggcggccaacatcac
tctccggtctccaggttcacgttctccacgagccctccgttaagctccggggtcgcggtg
gcgagggagacggcgaattactccagcccgctgaacatctccgccggagggagggagcac
tacggttcccgcggtctgagcggatcctatcaccgcggatacccggattacttgagcccc
aacatcggaggctcttgggcggcgtcgcactttgacagctccgttctgcacagcctccag
agcggcggagcgcccggggcaacgcggcaccacaatttagagctgctggaggatttctct
gaggatcgtgagtgtgtgaactgcggggcgatgtccactcctctgtggcggcgggacggg
acgggtcattacctgtgtaacgcctgcggtctctatcacaagatgaacaggatcaaccgg
ccactcatcaaaccgcagagacgactgtctgcatccagacgggttggtttgtcctgcact
aactgtcagacgaccacaaccactctctggagacgtaacgcagaagcagagccggtctgc
aacgcctgcggactctacatgaaactccacggggttcctcgtcctctcgccatgaagaaa
gagggaattcaaacccgcaaacgcaaaccaaaaaacatcagcaagtccaaacctgggtca
tctgagggtcagacggtgtccagtgctatgaactccagtcccacagaagaaccgcgacct
ataaagacggagccggacacggcttcactctacacacaccacaacacatcgatgaacaca
ccggtctctgtgtttctgtcgtatatgggaactccaagctcaagttctgctctcaaactt
tctccaagtggatcttccagctccaaaagcgaagtgtggaacagcctgattctggcataa

DBGET integrated database retrieval system