KEGG   Sinocyclocheilus grahami: 107557358Help
Entry
107557358         CDS       T04918                                 

Gene name
ace
Definition
(RefSeq) angiotensin-converting enzyme
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
sgh  Sinocyclocheilus grahami
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sgh01002]
    107557358 (ace)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sgh04147]
    107557358 (ace)
   04090 CD molecules [BR:sgh04090]
    107557358 (ace)
Enzymes [BR:sgh01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     107557358 (ace)
Peptidases [BR:sgh01002]
 Metallo Peptidases
  Family M2
   107557358 (ace)
Exosome [BR:sgh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107557358 (ace)
CD molecules [BR:sgh04090]
 Proteins
  107557358 (ace)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2 Peptidase_M32 RIFIN FixQ
Motif
Other DBs
NCBI-GeneID: 107557358
NCBI-ProteinID: XP_016096235
LinkDB All DBs
Position
Unknown
AA seq 1281 aa AA seqDB search
MYRAVVLLTLISTSAALKPEWIPGDYHMTEAGAESFVSDYNSTAEEVFYFSTEASWNYNT
NLTNHNSQMQIAASLEEQAFTEAWGQKAKATFSDSLMDTFTNPDLKKIINNINVLGPANL
PTAEREKYNTILSQMDSIYSTAKVCPSEECWSLEPELTEIMATSRSYKRLLYAWEGWHNA
SGVPLRSLYSEFVELSNKASRMDGVNDTGAYWRSWYESPTFEQDLENLFKQLEPLYQNLH
AFVRRKLYNYYGPKYINLKGPIPAHLLGNMWSQTWNNIYNMMIPFPDKSNVDVTDTMVAK
GYNATHMFRVAEEFFTSLGLLKMPPEFWDKAMLEKPTDGREVVCHASAWDFYNRKDFRIK
QCTTVTMEQLFTVHHEMGHVEYYLQYKEQPVSFRRGANPGFHEAVGDVLSLSVSTPKHLH
TIGLLEQLTDDAESDINYLLKMALEKIAFLPFGYLIDQWRWGVFSGRTPPERYNADWWYL
RTKYQGICPPTRRTEEHFDAGAKYHIPGNTPYIRYFVSFILQFQFHEKLCQEAGHTGPLH
KCDIYRSKEAGAVLEKVLKAGSSKPWTEVLQEALGTNRMDASPLMSYFEPVTTWLQEQNA
KMGETLGWPDFNWVPPVPEGYPEDIGKITDEMLAKQFLEEYNSTAEEVWNAYTESSWTYN
TDITGANKKIMLQKNLEMANHTKIYGLEARKIDTSDFQDESVKRILTKLGDLERAALPEE
DLIEYNTLLASMETLYSVATVCKDESKCLPLDPDLNKIMAESRDYDELLFAWQGWRNASG
RELRNSYKRYVELANLAAKSNGHTDNGAFWRSLYETPTFEEDLEALWKDLEPLYLNIHAY
VRRALYKKYGPEHINLKGPIPAHLLGNMWAQTWSAIMDLVIPYPDATQVDATPAMIAQGW
DPKRMFEESDRFFTSLGLLPMPPEFWNKSMLEKPTDGREVVCHASAWDFYNRKDFRIKQC
TVVTMDDLITVHHEMGHVQYFLQYKDQPISFRDGANPGFHEAIGDVLALSVSTPKHLQSI
GLLDKVEDNKESTINFLMSMALDKIAFLPFGYLMDQWRWKVFDGRISSSEYNKEWWNLRM
KYQGLCPPVPRTEEDFDPGAKFHIPANVPYVRYFVSFVIQFQFHEALCEAAGQPTPLHNC
DIYQSKEAGKLLGDVMKMGFSKPWPEAMTLITGQPKMSVQPLMEYFQPLIEWLVEENKKN
GDVLGWPQYDWTPYKITSVMDEKPKAISFLGLSVDEGGAVAGQWILLVLSIVFLLGIIYL
VYRYRKTKRLQDKSMSQMELK
NT seq 3846 nt NT seq  +upstreamnt  +downstreamnt
atgtaccgggcagtggtgctgctgactctcatcagcacgagtgcagctctgaaacccgag
tggatcccgggggattatcatatgacagaggcaggggctgagagcttcgtgagcgactac
aactcaacggccgaggaggtcttctacttcagcacagaggccagctggaactacaacacc
aacctgacaaatcacaattcacagatgcagattgctgcgtctttggaggagcaggctttc
acagaagcatggggtcaaaaagcaaaggctaccttcagtgattctctcatggataccttc
actaatccagacctgaagaaaatcatcaataatatcaatgttctgggacccgccaatctc
ccaactgctgagagagaaaagtacaataccattctgagccagatggacagcatctactca
actgcaaaggtgtgtccttcagaggaatgctggtctttggagcctgagctcacagaaatc
atggctacctcaagaagctataagaggcttctgtatgcctgggaaggctggcacaacgcc
tcaggggtcccactcagatccctctactctgagtttgtggagctcagcaacaaggcatct
cggatggacggcgttaacgatacaggcgcatactggcgttcctggtacgaatctccaacc
tttgagcaagacctagagaatctgtttaaacagctggaacctctctaccaaaacctgcac
gcctttgtccgccgaaagctctataactactacggtcctaaatacatcaacctcaagggt
cccatccctgcccacctcttgggcaacatgtggtcacaaacgtggaacaacatctacaac
atgatgattccttttcctgacaagtccaatgtagatgtgacggacaccatggttgctaaa
ggttataatgccactcacatgttccgggttgccgaggagttcttcacctctctgggtttg
ctcaaaatgcctcctgagttttgggacaaggccatgctggagaaacccactgatggaagg
gaggtggtctgccatgcctctgcctgggacttctacaaccgcaaagacttcagaatcaaa
cagtgcaccactgtgactatggagcagcttttcaccgtgcatcacgagatgggccatgtg
gaatattacctccagtacaaagagcagccggtcagcttcaggagaggagccaatcctggc
ttccatgaggccgtaggggatgtgctgtctctgtctgtctccacacccaaacatctccac
actatcggcctcctggaacaactgaccgatgatgctgagagtgatatcaactacctgttg
aagatggctttggaaaagatcgccttccttccttttggatatcttattgatcagtggcgc
tggggtgtgtttagtggacggacaccgccagaacgttacaatgcagactggtggtacctc
aggacaaaataccaaggcatctgtccaccaaccagacgtacagaagagcattttgatgct
ggagcaaaatatcacattcctggaaacacaccgtacatcagatactttgtgagcttcatt
ctgcagttccagttccatgagaaattatgtcaggaggctggacatactggacctctgcac
aaatgcgatatctacagatccaaagaggctggagctgttttagagaaagtcttgaaggct
ggctcttcaaagccttggacagaggtgctacaagaggctcttggcactaacagaatggac
gccagccccctgatgagctattttgagccagttactacctggctgcaggaacagaatgcg
aaaatgggagagacgctgggctggcctgattttaattgggtgccaccagtaccagaaggc
taccctgaagacatcggtaaaataacagatgagatgctggccaaacagttcttagaggaa
tacaacagcacagccgaggaggtctggaacgcttacactgagtcctcgtggacctacaac
actgacatcactggagccaacaagaagatcatgctgcaaaaaaacttggagatggccaac
cacacaaagatctatggactagaggcccgtaagatcgacaccagtgacttccaggatgag
tcggtgaagagaatcttgacgaaactgggtgaccttgagagagctgcgcttcctgaagaa
gatctcatagagtacaatactttgctagcatccatggagaccctgtacagcgtagccaca
gtctgcaaggatgaatcaaagtgtctacctctagatccagatttgaataagatcatggcc
gagtccagggattatgacgagctgctgttcgcctggcagggttggcgcaatgcctccggc
agagagctccgcaacagctacaagagatatgtggagcttgccaacttagctgcaaagagc
aatggtcacacggataatggggcattctggcgttccctgtatgagacccccacctttgaa
gaggatctagaggccttgtggaaagatctagagccgctctacctcaacattcatgcctat
gtgcgcagggcactgtacaagaaatatggaccagaacacatcaaccttaaaggaccaatt
ccagctcatttgctcggaaatatgtgggcccaaacgtggtctgctatcatggaccttgtc
attccgtaccctgatgccacccaagtggatgccacgccagccatgattgcccaaggttgg
gaccccaaacggatgtttgaggaatcggaccggttcttcacttctctgggtcttctgccc
atgcctcctgagttctggaacaagtccatgctggaaaagccaacagatggacgtgaagtg
gtctgtcacgcatctgcttgggacttctacaaccgcaaagacttcaggatcaagcagtgc
acagtagtgaccatggatgacctcatcactgtgcaccatgagatgggccacgttcagtac
ttcctgcagtataaggatcaacccatctctttccgcgacggcgccaaccctggattccat
gaggccattggtgacgttttggccctgtcagtttccacacctaaacatcttcagagcatt
ggcctgctggacaaggtggaggacaataaagaaagcaccatcaacttcctgatgagcatg
gccttggataagattgccttcctgccttttggctacctgatggaccagtggaggtggaag
gtatttgatggaaggatctcaagctcagagtacaacaaagagtggtggaacctgagaatg
aagtaccagggattgtgtccacctgtaccgcgcactgaggaagacttcgaccctggtgca
aagttccacatcccagctaatgtgccctacgtcaggtactttgtgagttttgtaatccaa
ttccagttccacgaagccctgtgtgaagcagctggtcagccaactccactccacaactgt
gacatctaccagtccaaagaagcagggaaactcctgggtgatgtgatgaagatgggcttc
agtaaaccctggcccgaagccatgactttgattactggccagcccaaaatgtcagtccag
cctctgatggagtacttccaaccgctcatcgagtggctggtggaggagaacaaaaagaat
ggtgatgtcctgggatggccacagtatgattggacgccttacaaaatcacttcagtgatg
gacgagaagccgaaagcaatcagtttcctgggtttgagtgtggatgagggaggcgctgtg
gcgggacagtggattctcctggttctgagcatcgtcttcttgcttggcatcatctattta
gtctacagatacaggaagactaaacgcttacaggacaaatcaatgtctcagatggagctc
aagtaa

DBGET integrated database retrieval system