KEGG   Sinocyclocheilus grahami: 107557900Help
Entry
107557900         CDS       T04918                                 

Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1-like
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh00562  Inositol phosphate metabolism
sgh01100  Metabolic pathways
sgh04020  Calcium signaling pathway
sgh04070  Phosphatidylinositol signaling system
sgh04261  Adrenergic signaling in cardiomyocytes
sgh04270  Vascular smooth muscle contraction
sgh04310  Wnt signaling pathway
sgh04371  Apelin signaling pathway
sgh04540  Gap junction
sgh04621  NOD-like receptor signaling pathway
sgh04912  GnRH signaling pathway
sgh04916  Melanogenesis
sgh04933  AGE-RAGE signaling pathway in diabetic complications
Module
sgh_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107557900
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107557900
   04371 Apelin signaling pathway
    107557900
   04020 Calcium signaling pathway
    107557900
   04070 Phosphatidylinositol signaling system
    107557900
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107557900
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    107557900
  09152 Endocrine system
   04912 GnRH signaling pathway
    107557900
   04916 Melanogenesis
    107557900
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107557900
   04270 Vascular smooth muscle contraction
    107557900
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107557900
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sgh04131]
    107557900
Enzymes [BR:sgh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     107557900
Membrane trafficking [BR:sgh04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    107557900
 Endocytosis
  Macropinocytosis
   Phospholipase C
    107557900
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PLC-beta_C PH_14 PI-PLC-Y EF-hand_like C2 DUF1154
Motif
Other DBs
NCBI-GeneID: 107557900
NCBI-ProteinID: XP_016096962
LinkDB All DBs
Position
Unknown
AA seq 1285 aa AA seqDB search
MCEICGSSSSSSGRMAGAQPGVHALQLKRVSVTESLRTGDKFIKWDDDCTTVTPVTLRVD
PQGYFLYWTDQNKETDLLDVSLIKDTRNGRFAKMPKEAKQRELLDVGTLEGRLENRTLTV
VSGADMVNITCLNFTAFSEEVAKEWAEELFSLALNLLAQNMSRESCLEKVYTRLTLQLTA
EGGIPVKNIFRLFSADRRRVENSLEVCGLPTGRNDTVPQDTFTPDVYRQLLNNICPRNDI
DTIFSEIGAKIRPYLTVEQMTDFLNNRQRDPRLNEILYPPLKAEQVQGLVEKYEPDTMLS
RRGQISVEGFGRYLSGEENSIIPPEKLDQSEDMTLPLSHYFINSSHNTYLTGQPIRRLAQ
HLPHRSANQTPRTTPTSQVSQSDASHNTYLTAGQLAGNSSVEMYRQVLLSGCRCIELDCW
KGRTADEEPIITHGFTMTSEICFKEVIEAIAESAFKTSPFPVILSFENHVDSPKQQAKMA
EYCRSIFGDALLTDPLEKYTLEAGVPLPSPVDLMGKILIKNKKNSHKADGSTKKKLSEQT
SITCSDTSSLCEPSSPSAGSTHQETPDSAHADGNERGQRRLQGMKSIDKTTGSLLINACL
ADDKGEADAESDAEEDNDESKKSMDEGTVNEAFATEEMSNLVNYIQPVKFNSFEACKKID
RSYEMSSFVETKALELLKESPVEFVEYNKLQLSRIYPKGTRVDSSNYMPQVFWNAGCQLV
ALNFQTIDLPMQLNLGIFEYNGKCGYRLKPEFMRRTDKQFDPFTQNTVDGIVAHTLSVKI
ISGQFLSDKRVGVYVEVEMFGLPVDTKRKAFKTKTSQSNAVNPVWDEDPVVFKRVVLPTL
ASLRIAVYEENGKFIGHRIIPVCAIRPGYHYISLRNEKNQTLTLPSVFIYTEVKDYVPDT
FADVIEALSNPILYISLMEQRANQLAALTQEEGAQETDREEVSGGGDPVSEVKTDPKPAA
ENGLNHDSISPKSSVVSHQTSSSGSVKPAVKSEDVVQSVLTEVDAQTVDELKQMKGYLRE
QKRQYKELKELMRKHNKKTNELINEHASRQKQLRRSVQKRIVSDQDQDQDLLEQERCEKL
KEQQQRQLLTLRQEQFYSEKYLKREHVKLLVEKLTTVAEECQNNQLKKLKDLCEKENKDL
KKRMDKRRQEKFQEARTLEKTLTEEKKMEMNRSHVNEVVQSIKRLEEAQDKRLERLLEKH
KDIRQQILDDKAKLQSELDQEYQDKFRRLPAEIQEFVQDSAACKGKFSQDSDFLPISRTP
GKLKPSLSPAEDVERSSEKVFDTPL
NT seq 3858 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgagatctgcgggagcagcagcagcagcagcggacgcatggcgggggcgcagccg
ggggttcacgcgctccagctcaaacgcgtgtcggtgaccgagagcttgaggaccggcgac
aaattcattaaatgggacgatgactgcaccacagttacgccggtgacgttgcgtgtggat
ccgcagggctacttcttgtactggaccgatcagaataaggagaccgacctgttagacgtg
tcgctcatcaaggatacgagaaatgggagatttgccaagatgccaaaggaggccaagcag
cgagagcttctggatgtggggactctggaggggaggctggagaaccggacactcacagtg
gtcagcggtgcagacatggtcaacatcacctgcctgaactttacagccttcagtgaagag
gtggccaaggagtgggccgaagagcttttcagcttggcgttgaacctgctggctcagaac
atgtccagagaatcctgtctggagaaagtgtacaccagactgacgctacagctgacggcc
gagggtgggattcctgtgaaaaatatcttccgtctgttctcggccgacagacggcgggtt
gaaaactctctggaggtctgcggcctgccgacgggacgaaatgacaccgttcctcaggat
acatttacacctgacgtataccgacagctcctgaacaacatttgtccgcgaaacgacatt
gatacgatcttctcagaaatcggcgctaagatccggccgtacctcaccgtagagcagatg
acagatttcctgaacaacagacagagagaccctcgtctgaatgagatcctgtacccgcca
ctcaaagccgagcaagtgcagggattggtggagaaatacgagcctgacaccatgctttca
cgaagagggcagatctcggtggagggcttcggcagatatctgagcggagaagagaacagt
atcatccctccagagaagctggaccagagtgaagacatgacgctgccgctctcgcattac
ttcatcaactcctcgcacaacacctacctcacaggtcagccaatcagacgcctcgcacaa
cacctacctcacaggtcagccaatcagacgcctcgcacaacacctacctcacaggtcagc
caatcagacgcctcgcacaacacctacctcacagcgggtcagctggcgggaaactcgtct
gtggagatgtaccggcaggttctgctctccggctgtcgctgtatagagctggactgctgg
aagggacgcaccgccgacgaggagcccatcattacacacggcttcaccatgacctcagag
atctgcttcaaggaggtgatcgaggccatcgcagagagcgccttcaagacgtctccgttc
ccagtcatcctgtcctttgagaaccatgtggactctcccaaacagcaggcgaagatggcc
gagtattgccgatcaatatttggagacgcattgctcacagacccactggagaaatacacc
ttggaggccggtgttcctctgcccagccccgtggacctgatgggcaaaatcctcatcaag
aacaagaagaattcccacaaagccgacggcagcaccaagaagaagctctccgagcaaacg
tccatcacctgcagtgatacgtccagtctgtgcgagccctcgtctcccagcgcaggatcc
acacatcaggagacgccagacagcgctcacgcagacgggaacgagagaggccaaaggagg
ttgcagggaatgaagtccattgataaaacgactgggtcactattaattaacgcttgtctg
gccgatgacaaaggggaagcagacgcagagagtgatgcggaggaagataacgatgaaagt
aagaagtccatggatgaggggacggtaaatgaagccttcgccacagaggagatgtccaac
ttagtcaactacattcagcctgttaaattcaactccttcgaggcgtgcaaaaaaatcgat
cgaagttatgaaatgtcatcgtttgtggagaccaaagcgctggagctgctcaaagaatcg
cccgtggagttcgtcgagtataataaactgcagctgagcagaatttatcccaaaggaact
cgagtggactcctcgaactacatgcctcaggtcttctggaacgccggatgtcagctggtc
gctctgaacttccagaccatagatctgcccatgcagctgaatctgggcatctttgagtac
aacgggaagtgcggctacagactgaagccagagttcatgcgacggacggacaaacagttt
gacccgttcactcagaatacagtcgacgggatcgtagcgcacacgctgtctgtgaagatc
atatccggccagtttctgtccgataagagagtcggtgtttacgtggaggtggaaatgttc
ggcctgccggtggacaccaaacggaaagcgtttaagaccaagacgtctcaaagcaatgcc
gtcaatccggtgtgggatgaagatccagtggtcttcaaaagagtggttcttcccacgctg
gcatcattgaggatagctgtgtacgaagagaacgggaagtttatcggccatcgcatcatc
ccagtgtgtgccatccgacccggatatcattacatcagtctgaggaacgagaagaaccag
acgctgacgcttccgtccgtcttcatctacactgaggtcaaggactacgtcccagacacc
tttgcagacgtgatcgaggccctgtccaatcccatcctgtacatcagtctgatggagcag
agagccaatcagctggcggctctgacacaagaggagggagcgcaggagaccgacagagaa
gaggtcagtggcggtggagatcctgtgtcagaggtcaagactgaccctaaacccgccgca
gagaacgggctgaaccacgacagcatctcgcccaaatcctccgtggtcagtcaccagacg
tcatcctcagggtccgtcaaacctgctgtgaagtctgaggatgtggtccagagtgtttta
acagaggtggacgctcagactgtagatgaactgaaacagatgaagggttatttgagggag
cagaagaggcagtacaaagaactaaaggagctcatgaggaaacacaacaagaaaacgaac
gagctgatcaacgaacacgcgtccagacagaagcagctgcgcaggtctgtgcagaagagg
atcgtgtcggatcaggatcaggatcaggatctgctggagcaggagaggtgtgagaaactg
aaggagcagcagcagcggcagctcctcacgctcagacaggagcagttctacagcgagaag
tacctcaaacgagagcacgtcaaactgcttgttgagaagttgacgactgtggcagaagag
tgtcagaataaccagctgaagaaactgaaggatctgtgtgagaaagaaaacaaagacttg
aagaaaaggatggacaagagacgacaagagaagtttcaagaagcccgaacgctggagaag
actctgactgaggagaaaaagatggagatgaacagatcacacgtgaacgaggtggtgcag
tccatcaaacggctggaagaagctcaggacaaacgactggagagattgctggaaaaacat
aaagatattcgacagcaaatcctggacgacaaagcaaagcttcagagcgagctggaccag
gagtatcaggacaagtttcggaggctcccagcagaaatccaagagttcgtgcaggactct
gctgcttgtaaaggcaagttcagccaagacagtgactttcttcccatttccagaacgcca
gggaagctgaagccctcgctctcgccagctgaagatgtggagcgatcttcagagaaagtc
ttcgacacgccactctga

DBGET integrated database retrieval system