KEGG   Sinocyclocheilus grahami: 107558060Help
Entry
107558060         CDS       T04918                                 

Definition
(RefSeq) netrin receptor DCC-like
  KO
K06765  deleted in colorectal carcinoma
Organism
sgh  Sinocyclocheilus grahami
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_3 I-set Ig_2 ig V-set C2-set_2 Ig_5 Ig_4 Ig_6 Ig_C17orf99
Motif
Other DBs
NCBI-GeneID: 107558060
NCBI-ProteinID: XP_016097157
LinkDB All DBs
Position
Unknown
AA seq 460 aa AA seqDB search
MGCVTGDIHRSRLYALLIGLHVLTGVSKTHGSDARRSFVELRFVLEPQDAVTVRGGVLQL
DCEARSDQGVPVISWKKDGVLLSAVVDERRQQLSNGSLLVQNVLHSRHHRPDEGSYQCLA
LLEGLGAIVSRTAEVSVAGPLRVVVPTESVSAHLGDTALLRCEVTGEPMPVVRWQKNRED
LPLTFDPDSRVVILPSGSLQVSRIQPPDSATYRCLTENPSSSRTGTDADLRVIPEPGVAR
ALTFLQRPQKVTALQGRDAVLECSASGYPTPSFYWMRGDELIQSRSKKYSLLSASNLLIS
SVTDDDSGAYTCVAHNKQQNISAPCELSVLVPPQFLSYPSNTYAYESTDIEMECAVTGNP
QPTVRWVKNGEAVIPSDYFQIVEGGHLQILGLVRSDEGFYQCIAENEAGNSQAMAQLILL
QPAVLTDTQKLLSMEPECKLNPSQINWDKDETRGDDLRRG
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgggctgcgtcactggagatattcaccggagcagactttacgcactcctcatcgggctg
catgttctcaccggtgtctccaaaacgcacggctcggatgctcggcggtctttcgtggag
ctgcggttcgtgctggagccgcaggacgcggtgacggttcggggcggtgtgctgcagctg
gactgcgaggcgcgctcggatcagggcgttccggtcatctcctggaagaaggacggtgtg
ctgctgagcgcggtggtggacgagcgcagacagcagctttccaacggatcgctcctggtg
cagaacgtgctgcactcgcgccaccaccgtccagacgagggctcgtaccagtgcctggcc
ttgctggagggcctcggagccatcgtcagccgcaccgctgaagtctccgtcgccggtcct
ctacgcgtggtcgtccccactgagtcggtctcggctcatctgggcgacacggctctgctg
cgctgcgaggtgacgggcgagcccatgcccgtggtgcgctggcagaagaacagggaggac
ctgcccttgacttttgaccccgacagcagagtggtcatcctgccctccggatctctgcag
gtcagcagaatccagccgccggactcggccacataccgctgtctgacggagaaccccagc
agctcccgcaccggcacagacgccgacctgcgcgtcataccggagcccggagtagcgcga
gcactgacgttcctccagaggcctcagaaggtcacggctctacagggcagagatgcggtt
ctagaatgttccgcctccggctatcccaccccatccttctactggatgagaggagacgag
ctgatccagagcagatcaaagaagtactctctcctgagcgccagcaaccttctgatcagc
agcgtcacagacgacgactcgggagcatacacctgcgttgctcacaacaaacagcagaac
atctccgcgccctgcgagctctccgtgctcgtgcctcctcagttcctcagctacccgtcg
aacacgtatgcgtatgaaagcacggacatcgagatggagtgtgccgtgacgggaaacccg
cagcccaccgtccgctgggtgaagaacggagaggccgtcattcccagcgactacttccag
atcgtggagggcggtcatctccagattctgggtctggttcgctcagacgagggtttctat
cagtgtatcgctgagaacgaagcgggaaacagtcaggcgatggctcaactcatcctgctg
cagcccgctgtcctgacagacacacaaaaactgctctctatggagcctgagtgtaaactc
aatccatcccagattaattgggacaaggatgagaccagaggagatgatctgagacgagga
tga

DBGET integrated database retrieval system