KEGG   Sinocyclocheilus grahami: 107558335
Entry
107558335         CDS       T04918                                 

Definition
(RefSeq) transcriptional regulator Myc-1
  KO
K04377  Myc proto-oncogene protein
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04012  ErbB signaling pathway
sgh04110  Cell cycle
sgh04218  Cellular senescence
sgh04310  Wnt signaling pathway
sgh04350  TGF-beta signaling pathway
sgh05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107558335
   04012 ErbB signaling pathway
    107558335
   04310 Wnt signaling pathway
    107558335
   04350 TGF-beta signaling pathway
    107558335
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107558335
   04218 Cellular senescence
    107558335
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107558335
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sgh03000]
    107558335
   03019 Messenger RNA biogenesis [BR:sgh03019]
    107558335
Transcription factors [BR:sgh03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    107558335
Messenger RNA biogenesis [BR:sgh03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     107558335
SSDB
Motif
Pfam: Myc_N HLH Myc-LZ Pep1_7
Other DBs
NCBI-GeneID: 107558335
NCBI-ProteinID: XP_016097473
UniProt: A0A672P0C4
LinkDB
Position
Unknown
AA seq 388 aa
MPVIASLAYKNYDYDYDSIQPYFYFDNDDEDFYHHQQGQTQPPAPSEDIWKKFELLPTPP
LSPSRRQSLSTAEQLEMVSEFLGDDVVNQSFICDADNSQSFIKSIIIQDCMWSGFSAAAN
LEKVVSERLASLHAARKELMSDSSSNRLNASYLQDMSTSASECIDPSVVFPYPLTESSKF
SKVAPSEPMLVLDTPPNSSSSSGSDSEEEEEEEEEEEEIDVVTVEKRQKRNETEVSDSRY
PSPLVLKRCHVSTHQHNYAAHPSTRHYQPAVKRLRLEASSNNSSRHVKQRKCTSPRTSDS
EDKDKRRTHNVLERQRRNELKLSFFALRDEIPEVANNEKAAKVVILKKATECIHSIQLDE
QRLLSIKEQLRRKSEQLNHSLQLLRSSH
NT seq 1167 nt   +upstreamnt  +downstreamnt
atgccggtgattgcgagtttggcgtataaaaactacgattacgactacgactccatccag
ccctatttctatttcgacaacgacgatgaggatttctatcaccaccagcaaggacagact
caacctccagctcccagcgaggacatatggaagaaattcgagctgctgcccacaccgccc
ctctcacccagccggagacagtcgctctccaccgccgagcagctggagatggtcagcgag
ttcctgggagacgacgtggtcaaccagagcttcatctgcgacgcggacaactcccagtcc
ttcatcaagtccatcatcatccaggactgcatgtggagcggcttttccgcagctgccaat
ttggagaaagtggtttctgagagactagcgtccctgcacgctgctaggaaagaactgatg
tctgacagcagctcaaatcgactcaatgcaagttatttgcaggatatgagcacctctgca
tcagaatgcatcgacccttctgtggtcttcccgtatcccctcacggagtccagcaaattc
agcaaggttgctccatcagaacccatgcttgtcctggacactccacctaacagctccagc
agcagtggcagtgattctgaagaggaggaggaggaggaagaggaagaggaagaaattgat
gtggtgactgtggaaaagcgacagaaaagaaacgagacggaggtgtcagattcgaggtac
cccagtcccctggtgttgaagcgctgtcacgtctccacccaccagcacaactacgctgcc
cacccctccacacggcattaccagccggctgtcaagaggctacgactggaggccagcagc
aacaacagcagcaggcatgtgaaacaacgcaagtgcacgagtccccggacatcggattct
gaggacaaagacaaacgcaggactcacaatgtgctggagcgccaacgcagaaacgagctc
aaactcagctttttcgcattacgggatgagatccctgaggttgcaaataacgagaaagcc
gctaaagtggttatcctaaaaaaggcgacagagtgcatccacagcatacagttggatgag
caaaggctgctgtccatcaaagaacagctgaggcgaaagagtgaacagttaaatcatagc
ctgcagctgctgcgaagttcacattaa

KEGG   Sinocyclocheilus grahami: 107584016
Entry
107584016         CDS       T04918                                 

Definition
(RefSeq) transcriptional regulator Myc-B isoform X1
  KO
K04377  Myc proto-oncogene protein
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04012  ErbB signaling pathway
sgh04110  Cell cycle
sgh04218  Cellular senescence
sgh04310  Wnt signaling pathway
sgh04350  TGF-beta signaling pathway
sgh05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107584016
   04012 ErbB signaling pathway
    107584016
   04310 Wnt signaling pathway
    107584016
   04350 TGF-beta signaling pathway
    107584016
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107584016
   04218 Cellular senescence
    107584016
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107584016
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sgh03000]
    107584016
   03019 Messenger RNA biogenesis [BR:sgh03019]
    107584016
Transcription factors [BR:sgh03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    107584016
Messenger RNA biogenesis [BR:sgh03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     107584016
SSDB
Motif
Pfam: Myc_N HLH Myc-LZ GOLD_2
Other DBs
NCBI-GeneID: 107584016
NCBI-ProteinID: XP_016125902
UniProt: A0A672PUM0
LinkDB
Position
Unknown
AA seq 396 aa
MPLNSSMASKNYDYDYDSYQPYFYFDNEDEDFYNHQHGQPPAPSEDIWKKFELLPTPPLS
PSRRPSLSDPFPSTADQLEMVSEFLGDDVVNHSFICEADYSQSFLKSIIIQDCMWSGFSA
AAKLEKVVSERLASLQAARKESSRSDSVDGCRSSPNLSYLQDMSTPASQCIDPSVVFPFP
LTDSSKPSKPSSTSTSTTLPLDTPPNSGSSSDSDSDDEEEEEEEEEEEIDVVTVEKRKSV
RKPDANATHQSPVVLKRCHVNIHQHNYAAQPSTRSEQPAVKRIKFESNIRVFKQMNHNRK
CTSPRTSDSEDNDKRRTHNVLERQRRNELKLSFFALRDVIPDVANNEKAAKVVILKKATE
CIATIQEDEQKLISLKEQLRRKCEHLKRRLEQLSSS
NT seq 1191 nt   +upstreamnt  +downstreamnt
atgccgctgaattcaagtatggcgagtaaaaattacgattacgactacgactcctaccag
ccctatttctatttcgacaacgaggatgaggatttctataaccaccagcacggacagcca
ccggcgcccagtgaggatatatggaagaaatttgaactgctccccactccgccgctctcc
ccgagccggcgtccctcgctgtcagaccccttcccctccacggccgaccagctggaaatg
gtgtcggagtttctcggggacgacgtggtcaaccacagttttatttgcgaggcggactac
tcccagtcttttctaaagtcgattatcattcaggactgtatgtggagtggtttctccgcc
gcggctaaactggagaaggtggtgtcggagagattagcgtcgctgcaggcggcgaggaaa
gagtcttccaggagcgactctgtggacggctgtcggtccagccccaacctcagctacctt
caggacatgagcacccctgcctcacagtgcattgacccatcagtggtgttccctttcccg
ctgactgacagctcaaagccgtctaaaccgtcatccacatcgacttccacaacactgcca
ctggatactccaccaaacagtgggagcagcagtgacagcgattccgatgacgaagaggaa
gaggaggaggaggaggaggaggaaatcgacgttgtcacggtggaaaagagaaagtctgtg
agaaagcctgacgcaaacgcaacgcatcaaagccccgtcgtcctcaagcggtgccacgtt
aatattcaccaacacaattacgctgcgcagccatccacgcggagcgagcagcctgcggtc
aagcggattaaattcgagagtaacatccgggtgtttaaacaaatgaaccacaaccgtaaa
tgcacgagtcccaggacgtcggactctgaggataacgacaaacgcaggactcataacgtg
ctcgagcggcaacggcggaacgagctcaaactcagcttcttcgcgctgagagacgtgatt
cctgacgtggccaacaacgagaaagctgccaaagtggtgatactcaagaaggcgacggag
tgcatagcgaccatacaagaagatgaacaaaaactgatctcgcttaaggagcaattaagg
aggaaatgtgaacatttgaaacggagacttgagcagctaagcagttcttaa

KEGG   Sinocyclocheilus grahami: 107589955
Entry
107589955         CDS       T04918                                 

Definition
(RefSeq) transcriptional regulator Myc-2
  KO
K04377  Myc proto-oncogene protein
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04012  ErbB signaling pathway
sgh04110  Cell cycle
sgh04218  Cellular senescence
sgh04310  Wnt signaling pathway
sgh04350  TGF-beta signaling pathway
sgh05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107589955
   04012 ErbB signaling pathway
    107589955
   04310 Wnt signaling pathway
    107589955
   04350 TGF-beta signaling pathway
    107589955
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107589955
   04218 Cellular senescence
    107589955
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107589955
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sgh03000]
    107589955
   03019 Messenger RNA biogenesis [BR:sgh03019]
    107589955
Transcription factors [BR:sgh03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    107589955
Messenger RNA biogenesis [BR:sgh03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     107589955
SSDB
Motif
Pfam: Myc_N Myc-LZ HLH NOA36 PAC1 TLP-20
Other DBs
NCBI-GeneID: 107589955
NCBI-ProteinID: XP_016134033
UniProt: A0A672T8T7
LinkDB
Position
Unknown
AA seq 407 aa
MPVSASLAYKNYDYDYDSIQPYFYFDNDDEDFYHHQQGQTQPPAPSEDIWKKFELLPTPP
LSPSRRQSLSTAEQLEMVSEFLGDDVVSQSFICDADYSQSFIKSIIIQDCMWSGFSAAAK
LEKVVSERLASLHAARKERMMSDSSSNRLNASYLQDLSTSASECIDPSVVFPYPLTESSK
SSKIAPSEPMLVLDTPPNSSSSSGSDSEDDEEEEEEEEEEEEEEEEEEEEEIDVVTVEKR
QKRNEAEVSDSRYPSPLVLKRCHVSTHQHNYAAHPSTRHDQPAVKRLRLEASSSSNNSTS
SSNRHGKQRKCTSPRTSDSEDNDKRRTHNVLERQRRNELKLSFFALRDEIPEVANNEKAA
KVVILKKATECIHSMQLDEQRLLSLKEQLRRKSEQLKHRLQQLRSSH
NT seq 1224 nt   +upstreamnt  +downstreamnt
atgccggtgagtgcgagtttggcgtataaaaactacgattacgactacgactccatccag
ccctatttctacttcgacaacgacgatgaggatttctatcaccatcagcaaggacagact
caacctccagctcccagcgaggacatttggaagaaattcgagctgctgcccacaccgccc
ctctctcccagccggagacagtcgctctccaccgccgagcagctggagatggtcagcgag
ttcctgggagacgacgtggtcagccagagcttcatctgcgacgcggactactcccagtcc
ttcatcaagtccattatcatccaggactgcatgtggagcggcttttccgccgctgccaag
ttggagaaagtggtttctgagagactggcgtccctgcatgctgctaggaaggaacggatg
atgtctgacagcagctcaaatcgactcaatgcaagttatttgcaggatctgagcacctct
gcatcagaatgcatcgacccttctgtggtctttccgtatcccctcacggagtccagcaaa
tccagcaagattgctccatcggaacccatgcttgtcctggacactccacctaacagctcc
agcagcagtggcagtgattctgaagatgatgaagaagaggaggaggaggaggaggaggaa
gaagaagaagaggaggaagaagaagaggaagaaattgatgtggtgactgtggaaaagcgt
cagaaaaggaacgaggcggaggtgtcggattcaaggtaccccagtcccctggtgttgaag
cgctgtcacgtctccacccaccagcacaactacgctgcccacccttccacgcggcacgac
cagccggctgtcaagaggctacgactggaggccagcagcagcagcaacaacagcaccagc
agcagcaacaggcatgggaagcaacgcaagtgcacgagtccacggacatcggattctgag
gacaatgataaacgcaggactcacaatgtgctggagcgccaacgtagaaatgaactcaaa
ctcagctttttcgcactacgggatgagatccctgaggttgcaaataacgagaaagctgct
aaagttgttattctaaagaaggcgacagagtgcatccacagcatgcagttggatgagcaa
aggttgctgtccctgaaagaacagctgaggcgaaagagcgaacaattaaaacacaggctg
cagcagctgcggagttcacattaa

DBGET integrated database retrieval system