KEGG   Sinocyclocheilus grahami: 107558456
Entry
107558456         CDS       T04918                                 

Definition
(RefSeq) putative fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107558456
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107558456
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sgh04052]
    107558456
   00536 Glycosaminoglycan binding proteins [BR:sgh00536]
    107558456
Cytokines and growth factors [BR:sgh04052]
 Growth factors
  Growth factors (RTK binding)
   107558456
Glycosaminoglycan binding proteins [BR:sgh00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   107558456
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 107558456
NCBI-ProteinID: XP_016097606
LinkDB
Position
Unknown
AA seq 125 aa
MDDGLIDEECDLQEKQVEQNDVYILLKVKAVKAGIVAIRGHKTGLYLAMDKYGKLYSTVM
LNDECCFIEKIEENHYNTYRSQKYQENGDWYVGIKKNGRMKNGSKTHKGQNAIYFLPIPV
DGSIQ
NT seq 378 nt   +upstreamnt  +downstreamnt
atggatgatggcttgattgatgaagaatgtgatttacaagaaaaacaagtggaacagaac
gacgtttacattcttttaaaggtaaaagcagtgaaggcaggaatagtggctattaggggt
cataagactggactatacctggcaatggacaaatatggaaaactttacagcactgtcatg
ttgaacgatgagtgttgcttcattgagaagatagaggagaaccactacaacacataccgc
tcacagaagtatcaggagaatggagactggtacgtggggatcaaaaagaacggacgcatg
aaaaacggctccaaaacacacaagggccaaaatgcaatctacttcctgccgattccagtg
gatggcagcatacagtaa

DBGET integrated database retrieval system