KEGG   Sinocyclocheilus grahami: 107558598
Entry
107558598         CDS       T04918                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B-like
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04012  ErbB signaling pathway
sgh04068  FoxO signaling pathway
sgh04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107558598
   04068 FoxO signaling pathway
    107558598
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107558598
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 107558598
NCBI-ProteinID: XP_016097745
UniProt: A0A672KWB5
LinkDB
Position
Unknown
AA seq 182 aa
MSNVRLSSGSPTLERMEARLSDQPKPSACRNLFGPVDHEELKKDFQRQLKAMEDASADAW
NFDFSSHTPRTDGRYQWDALDIRSVPGFYSRSVRAKGSELHMCSSGNNIDNNVDVNGNHD
CRVTEQSAETPEKDREQRKITSCLDSSGQSKRSHICVDEVTRTPRKPKKPRKHPSPTLTQ
TQ
NT seq 549 nt   +upstreamnt  +downstreamnt
atgtccaacgtgcgcttgtctagcggcagcccgacgctggaacggatggaggcgcgactg
tcagaccagcccaagccgtcggcgtgtcggaacctgttcggtccggtggatcatgaagag
ttaaagaaggatttccagcggcagctgaaggcgatggaggacgcgtcggcggacgcgtgg
aacttcgacttctcctcgcacactccgcgcaccgacggcagataccagtgggacgcgctg
gacattcgctcggtgcccggtttctacagcagatcggtgcgggcgaagggctccgagctt
cacatgtgctcctctgggaataatatcgataataatgtggatgttaacggcaatcacgac
tgtcgcgtaacggagcagagcgcggagacgcccgaaaaagaccgagagcagaggaaaata
acctcctgtctcgactcctcgggtcaaagcaaacgctcacacatctgtgtggatgaagtg
acacggacgccgagaaaacccaaaaaacccagaaaacaccccagcccgacacttacacaa
acccagtga

DBGET integrated database retrieval system