KEGG   Sinocyclocheilus grahami: 107558742Help
Entry
107558742         CDS       T04918                                 

Definition
(RefSeq) G-protein-signaling modulator 2-like isoform X1
  KO
K15837  G-protein signaling modulator 2
Organism
sgh  Sinocyclocheilus grahami
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sgh03036]
    107558742
Chromosome and associated proteins [BR:sgh03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    107558742
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GoLoco TPR_12 TPR_1 TPR_7 TPR_2 TPR_8 TPR_10 TPR_4 TPR_16 TPR_MalT MAS20 TPR_11
Motif
Other DBs
NCBI-GeneID: 107558742
NCBI-ProteinID: XP_016097896
LinkDB All DBs
Position
Unknown
AA seq 707 aa AA seqDB search
MCLRGSKPWVSCCTPWRIKHVYHTRGEKVMKKIKMSRRCAESSKKRKEKRMEASCLELAL
EGERLCKVGDYLAGVSFFESAIQVGTEDLQILSAIYSQLGNAYFHLHDYNKALEYHRHDL
TLTRTIGDQLGEAKASGNLGNTLKVLCRYDEAAVCCQRHLDISRMLHDKVGQARALYNYG
NVYHAKGKNICWSGMDPGEFPEVARIALKKATEYYEANLAIVKELGDRAAQGRTYGNLGN
SHYLLGNFQDAVLAHEQRLLIAKEFGDRAAERRAYCNLGNAYIFLGQFEVAAEHYKRTLQ
LVRQLKDRAVEAQACYSLGNTYTLLQDYERAIDYHLKHLIIAQDLKDRIGEGRACWSLGN
AYTALGNHEQAMSFAEKHLEISKEIGDRSAELTARMNVSDLQLVLGLKQNNSNTNSSAFI
ESPPGDSSLPDGRSRGSRRHNMENMELMKLSSDKNTGQACEESTTPQQTKSPTKSSIAKT
SSKPFFINRFRSKKHRLNGSNSSPPAENHSSSSPPLARLDKQYAPDTLGDDGFFDLLSRF
QGSRMDDQRCSLQDGLNRVHPSIPCETPPVALKKPISTPEAEASAQPGHFLDPLDSSQSR
RLDEQRASVDSLPGIRLDPRHSRDVLSKLMASADNREPDEDFFDMLIKCQGSRLDDQRCA
PPPPPTRGPTVPDEDFFSLILRSQGKRIDEQRVILPSDTRPLQTNPD
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgtgtctgagagggtcgaagccgtgggtctcatgctgcaccccgtggagaattaaacat
gtctatcacaccagaggagagaaagtcatgaaaaagattaagatgtctagacggtgcgct
gaaagttccaaaaagagaaaggaaaaaaggatggaggcctcatgtctggaactggctctg
gaaggtgagcgtctgtgtaaagtgggagattaccttgcgggtgtctccttttttgagtcg
gccatccaggtgggcacagaagacctgcagattttgagtgccatctacagtcagctgggc
aatgcctacttccacctgcacgactacaacaaggcgctggaataccatcggcatgacctc
acgctcaccagaactatcggagatcagctgggagaagctaaagccagtggtaaccttgga
aacactttgaaggttttgtgtcgctatgatgaagcagcagtttgttgccaaagacatctg
gacatttccaggatgctccatgataaggtggggcaggcccgagcgctgtataattacggg
aatgtgtaccacgccaaggggaagaacatatgttggagcggtatggaccctggagaattt
cccgaggtggcacgcatcgctctgaagaaagcaacagagtactacgaagcgaatctggcc
attgtgaaagagctgggggacagagcggcacagggcaggacctacggtaaccttggcaac
tcgcactatttgctcggaaacttccaggatgctgttctggctcacgaacagcgtctcctt
attgcaaaggagtttggagacagagctgcagagcggagagcatattgtaaccttggaaat
gcatacatattccttggacaatttgaagttgcagctgagcattacaagcggacgctgcag
ttggtgcggcagctgaaggacagggccgtggaggctcaggcctgctacagtctgggcaac
acctacacgctcctgcaggactatgagagagccatagactatcacctcaaacatctcatc
atagctcaggacctcaaggacaggatcggagaagggagagcgtgctggagtttaggaaac
gcctacaccgcactgggaaaccacgagcaggctatgagcttcgctgaaaaacatctggag
atctccaaagagattggagaccgtagtgcggagctgacggctcgaatgaacgtatctgat
ctgcagttagttttgggtctgaagcagaataattccaacactaacagctctgccttcatt
gagagtccgcccggtgacagcagtctacctgatggaagatccagaggaagcaggagacac
aacatggagaacatggagctcatgaaactcagctctgacaaaaatacgggccaggcctgt
gaggagtctacaacccctcagcaaaccaaatcgccaaccaaatcatccatagccaagaca
tcttctaaacctttcttcatcaatcgcttcaggagcaaaaaacacaggctgaatgggtca
aactccagtcctccagctgagaaccacagcagcagcagcccacctttagcccgtctggac
aaacagtacgccccagacactctgggtgacgatggcttttttgatcttctgagccgtttt
caaggcagtcgcatggatgaccaaaggtgctcgttacaggacggcctgaaccgtgttcac
ccttccattccctgtgaaaccccgcctgtagccttgaagaaacctatttccacgcccgaa
gcggaggcctcggcacagcctggccatttcctagacccgctggacagctcacagagccgt
cggctggacgagcagcgggctagtgtggacagtctcccgggtatccggctggacccgcgc
cacagccgggacgttctcagcaaactcatggcctcggccgataacagagaaccagatgaa
gacttcttcgacatgctgattaagtgccagggatccagactggatgatcagagatgtgct
cctccacctcctcccaccagaggccctacagtcccagatgaagacttcttcagcctcatc
cttcgctcccagggcaaacggatagatgagcagagagtcatcttaccatcagacacaaga
ccccttcagaccaatcctgactga

DBGET integrated database retrieval system