KEGG   Sinocyclocheilus grahami: 107559894Help
Entry
107559894         CDS       T04918                                 

Gene name
gstz1
Definition
(RefSeq) maleylacetoacetate isomerase isoform X1
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh00350  Tyrosine metabolism
sgh01100  Metabolic pathways
Module
sgh_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    107559894 (gstz1)
Enzymes [BR:sgh01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     107559894 (gstz1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C GST_C_2 GST_C_5
Motif
Other DBs
NCBI-GeneID: 107559894
NCBI-ProteinID: XP_016099398
LinkDB All DBs
Position
Unknown
AA seq 220 aa AA seqDB search
MSASAARVIKPVLYGYFRSSCSWRVRIAFALKGIEYEQKPVNLIKDGGQQLTDQFKAINP
MQQVPAVTIDGITLSQSLAIIQYIEETRPEPRLLPADPKQRGQVRIVCDIIASGIQPLQN
LYVLQKIGTEKVQWAQHFINRGFEALEPILKQTAGKYCVGDEISMADICLVPQVYNAERF
KVDMSQFPTIRRLNQTLIEIDAFKATHPSCQPDTPDDLQA
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcatccgctgcacgtgtaatcaagcctgttctttatggatattttagaagttca
tgctcttggagagtccggatagcgtttgcattgaaaggcattgaatatgagcaaaagcca
gtaaatctcatcaaggatggtgggcaacagctaacagatcagtttaaggcaataaaccca
atgcagcaagtgcctgcagtcaccattgatggcatcaccttgtctcagtcgttggccatc
atccagtacattgaggaaactcgtccagagccccgcctcctgccagcagacccaaagcag
aggggtcaggtccgcatcgtctgtgacatcatcgcgtctggaatccagcccctccagaat
ctgtatgtgcttcagaaaattggaacagagaaggtacagtgggctcaacatttcatcaac
cgaggattcgaggccttagagcctattctgaagcagacggcagggaaatactgtgttggt
gatgagatatccatggcagatatttgtcttgtgcctcaagtctacaatgctgaaaggttc
aaggtggatatgtcccagttccctactatcagaaggttaaaccagaccttaattgagatc
gatgctttcaaagccactcatccatcatgtcagcctgatactcctgatgatttgcaggca
taa

DBGET integrated database retrieval system