KEGG   Sinocyclocheilus grahami: 107560292
Entry
107560292         CDS       T04918                                 

Definition
(RefSeq) erythropoietin-like
  KO
K05437  erythropoietin
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107560292
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sgh04052]
    107560292
Cytokines and growth factors [BR:sgh04052]
 Cytokines
  CSF and other factors
   107560292
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 107560292
NCBI-ProteinID: XP_016099919
UniProt: A0A672LNW0
LinkDB
Position
Unknown
AA seq 183 aa
MFHGSGLFALLLMVLEWTRPGLSSPLRPICDLRVLNHFIKEAWDAEAAMRACQDACNIAT
NFTAPLTRVDFDDWEAMNIEEQAQEVQSGLHVLNEAISSLQASNQTDVLQSHIDASISNI
ASIRQVLRSLSIPEYVPPTSGGEDKEMQKVSSISELFQVHINFLRGKVHLLLANAPVCHQ
GVS
NT seq 552 nt   +upstreamnt  +downstreamnt
atgtttcacggttcaggactctttgccttactgctgatggtgctggagtggacccgtcca
ggcctgtcctccccattacgccccatctgtgacctgcgcgtcctcaaccatttcattaag
gaggcttgggatgcagaggctgctatgagagcgtgtcaggatgcttgcaacattgcaaca
aacttcactgctcctctgacaagagttgattttgatgactgggaagcaatgaatatagag
gagcaagctcaggaggtccagtcaggcttacatgtgctgaacgaggccatcagctcatta
caggcatctaatcaaactgacgtgctgcagtcccacatagatgccagtattagcaacatt
gccagcatcagacaagtgctgcgaagtctcagcataccggaatatgtacctcctaccagt
ggtggagaagacaaggagatgcagaaagtatcctcaatctcagagctgtttcaggtccac
atcaacttcctgcggggaaaagtgcatcttctgcttgccaatgcacctgtctgccatcaa
ggtgtcagctga

DBGET integrated database retrieval system