KEGG   Sinocyclocheilus grahami: 107560415
Entry
107560415         CDS       T04918                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit alpha-like
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04020  Calcium signaling pathway
sgh04114  Oocyte meiosis
sgh04140  Autophagy - animal
sgh04261  Adrenergic signaling in cardiomyocytes
sgh04270  Vascular smooth muscle contraction
sgh04310  Wnt signaling pathway
sgh04340  Hedgehog signaling pathway
sgh04371  Apelin signaling pathway
sgh04530  Tight junction
sgh04540  Gap junction
sgh04910  Insulin signaling pathway
sgh04912  GnRH signaling pathway
sgh04914  Progesterone-mediated oocyte maturation
sgh04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107560415
   04310 Wnt signaling pathway
    107560415
   04340 Hedgehog signaling pathway
    107560415
   04371 Apelin signaling pathway
    107560415
   04020 Calcium signaling pathway
    107560415
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107560415
  09143 Cell growth and death
   04114 Oocyte meiosis
    107560415
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107560415
   04540 Gap junction
    107560415
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107560415
   04912 GnRH signaling pathway
    107560415
   04914 Progesterone-mediated oocyte maturation
    107560415
   04916 Melanogenesis
    107560415
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107560415
   04270 Vascular smooth muscle contraction
    107560415
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sgh01001]
    107560415
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sgh03019]
    107560415
   03036 Chromosome and associated proteins [BR:sgh03036]
    107560415
Enzymes [BR:sgh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     107560415
Protein kinases [BR:sgh01001]
 Serine/threonine kinases: AGC group
  PKA family
   107560415
Messenger RNA biogenesis [BR:sgh03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     107560415
Chromosome and associated proteins [BR:sgh03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    107560415
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like
Other DBs
NCBI-GeneID: 107560415
NCBI-ProteinID: XP_016100081
LinkDB
Position
Unknown
AA seq 235 aa
MSLKEFLAKAKEDFLRKWDCQPQSTSCLDDFDRLKTLGTGSFGRVMLVKHRQSGRYYAMK
ILDKEKVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGY
PPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDLKNHR
WFATTDWIAIYEKKIDAPIIPKCRGPGDTSNFDEYDEEDIRVSVTEKCTNEFLEF
NT seq 708 nt   +upstreamnt  +downstreamnt
atgagcttgaaagaattcttggcaaaagccaaagaggacttcttgagaaaatgggactgt
cagccacagagcacatcgtgtctagatgactttgacagactgaaaactcttggcactgga
tcttttggaagagtaatgctagtcaagcacagacagtcgggacgatactacgctatgaag
attctggacaaagaaaaagtaacagactttggctttgccaaacgagtcaaaggcagaact
tggacgttgtgcggtacaccagagtacctggcaccagagatcattctcagcaagggctac
aacaaagctgttgactggtgggcattgggcgttctgatctacgaaatggctgctggatat
ccacctttcttcgctgatcaacctattcagatctatgagaaaattgtatctggcaaggta
cgatttccttcacactttagctcagacctgaaggatcttctgcgcaatctgctgcaggtg
gacctcacaaaacgctttggcaatttgaaaaatggagtcagcgacctcaaaaaccacaga
tggttcgctacaacagactggattgcaatctatgagaagaagattgatgctcccatcata
ccaaagtgcagaggacctggagacacaagtaactttgatgagtatgacgaggaagacatc
cgggtctcggtcacagagaaatgtacaaacgagttcttggagttttag

KEGG   Sinocyclocheilus grahami: 107562862
Entry
107562862         CDS       T04918                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit beta isoform X1
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04020  Calcium signaling pathway
sgh04114  Oocyte meiosis
sgh04140  Autophagy - animal
sgh04261  Adrenergic signaling in cardiomyocytes
sgh04270  Vascular smooth muscle contraction
sgh04310  Wnt signaling pathway
sgh04340  Hedgehog signaling pathway
sgh04371  Apelin signaling pathway
sgh04530  Tight junction
sgh04540  Gap junction
sgh04910  Insulin signaling pathway
sgh04912  GnRH signaling pathway
sgh04914  Progesterone-mediated oocyte maturation
sgh04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107562862
   04310 Wnt signaling pathway
    107562862
   04340 Hedgehog signaling pathway
    107562862
   04371 Apelin signaling pathway
    107562862
   04020 Calcium signaling pathway
    107562862
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107562862
  09143 Cell growth and death
   04114 Oocyte meiosis
    107562862
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107562862
   04540 Gap junction
    107562862
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107562862
   04912 GnRH signaling pathway
    107562862
   04914 Progesterone-mediated oocyte maturation
    107562862
   04916 Melanogenesis
    107562862
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107562862
   04270 Vascular smooth muscle contraction
    107562862
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sgh01001]
    107562862
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sgh03019]
    107562862
   03036 Chromosome and associated proteins [BR:sgh03036]
    107562862
Enzymes [BR:sgh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     107562862
Protein kinases [BR:sgh01001]
 Serine/threonine kinases: AGC group
  PKA family
   107562862
Messenger RNA biogenesis [BR:sgh03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     107562862
Chromosome and associated proteins [BR:sgh03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    107562862
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 107562862
NCBI-ProteinID: XP_016103091
LinkDB
Position
Unknown
AA seq 315 aa
MMGNTAAAKKGNELESETFVKEFLAKAKEDFLRKWESPPQSTTGLDDFDRLKTLGTGSFG
RVMLVKHKATDQFYAMKVLDKQKVVKLKQVEHTLNEKKILQAVSFPFLVRLEYAFKDNSN
LYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLID
QHGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGY
PPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLRNGVNDIKNHK
WFATTDWIAIYERKV
NT seq 948 nt   +upstreamnt  +downstreamnt
atgatgggaaacacagctgctgccaagaaaggcaacgagctggagagcgagacttttgtg
aaagagtttctagccaaagccaaagaagatttcttgagaaaatgggaatcaccaccacag
agcacaactggtttagatgactttgacagactgaagacgctgggcacgggctcttttggg
agagtcatgctggttaaacacaaggctacggatcagttctatgccatgaaagttctggac
aaacaaaaggtggtgaagttgaaacaagtggagcatacgctaaatgagaagaaaatatta
caagcagtatccttcccgttcctcgtcagattggaatatgccttcaaggacaactctaat
ttgtatatggtgatggagtatgttccaggaggggagatgttctcacatcttagaagaatc
ggaaggtttagtgaaccacatgcacggttttatgctgcacagattgtcctgacctttgag
tacctccactcactagacctcatctacagagacctgaaacctgaaaacctactcattgac
cagcatggatatatacaggtaacagactttggttttgcaaaaagagtaaaaggcagaacc
tggacattatgtggaactccagagtacttggcaccagagatcatcctcagcaagggatac
aacaaggctgtggactggtgggcccttggtgttctcatatatgaaatggcagctggatat
cccccgttttttgcagaccagcctattcagatctatgagaagattgtgtctggaaaggta
cgattcccctcgcacttcagttccgatctgaaagatcttttgaggaatctgctgcaggtg
gacctgaccaagcgctacggcaacctaaggaatggtgtcaatgatattaaaaaccacaaa
tggtttgccacaacagattggatagccatctatgagagaaaggtatga

KEGG   Sinocyclocheilus grahami: 107573599
Entry
107573599         CDS       T04918                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit alpha-like
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04020  Calcium signaling pathway
sgh04114  Oocyte meiosis
sgh04140  Autophagy - animal
sgh04261  Adrenergic signaling in cardiomyocytes
sgh04270  Vascular smooth muscle contraction
sgh04310  Wnt signaling pathway
sgh04340  Hedgehog signaling pathway
sgh04371  Apelin signaling pathway
sgh04530  Tight junction
sgh04540  Gap junction
sgh04910  Insulin signaling pathway
sgh04912  GnRH signaling pathway
sgh04914  Progesterone-mediated oocyte maturation
sgh04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107573599
   04310 Wnt signaling pathway
    107573599
   04340 Hedgehog signaling pathway
    107573599
   04371 Apelin signaling pathway
    107573599
   04020 Calcium signaling pathway
    107573599
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107573599
  09143 Cell growth and death
   04114 Oocyte meiosis
    107573599
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107573599
   04540 Gap junction
    107573599
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107573599
   04912 GnRH signaling pathway
    107573599
   04914 Progesterone-mediated oocyte maturation
    107573599
   04916 Melanogenesis
    107573599
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107573599
   04270 Vascular smooth muscle contraction
    107573599
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sgh01001]
    107573599
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sgh03019]
    107573599
   03036 Chromosome and associated proteins [BR:sgh03036]
    107573599
Enzymes [BR:sgh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     107573599
Protein kinases [BR:sgh01001]
 Serine/threonine kinases: AGC group
  PKA family
   107573599
Messenger RNA biogenesis [BR:sgh03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     107573599
Chromosome and associated proteins [BR:sgh03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    107573599
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 107573599
NCBI-ProteinID: XP_016115514
LinkDB
Position
Unknown
AA seq 274 aa
MGNTPAAKRGNEMESVKEFLAFAREDFLRKWENPAQSSELGSSCSPVQEMLNESFKAGLY
ALSEPHARFYASQIVLTFEYLHALDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTW
TLCGTPEYLAPEIILSKGYNKAVDWWALGVLMYEMAAGYPPFFADQPIQIYEKIVSGKVR
FPSHFSSDLKDLLRNLLQVDLTKRYGNLKNGVNDIKGHKWFSTTDWIAIYQRRVEAPFVP
KCRGPGDTSNFDDYEEEEIRVSFTEKCAKEFAEF
NT seq 825 nt   +upstreamnt  +downstreamnt
atgggcaacacgccggccgccaaacggggcaacgagatggagagcgtcaaagagtttttg
gccttcgccagagaagatttcctcaggaaatgggagaatcctgcacagagctcagagctg
ggttcatcgtgttcaccagtacaagaaatgctaaatgagtcgtttaaagcaggtttgtat
gctctcagtgaaccccatgcgcggttttatgcttcacagatagttttgacatttgaatat
ctgcatgccctcgacctgatctacagagaccttaaaccagagaacctcctcatcgatcag
cagggctatatacaggtgacagactttggcttcgcgaagcgggtcaagggtcgcacatgg
acattgtgcggcaccccggagtatctggccccagagatcatcctcagcaagggttataat
aaggctgtggactggtgggctctgggtgtgctgatgtacgagatggctgccggttatcct
ccgttttttgccgatcagcccattcagatctacgaaaagattgtctcaggaaaggtacgg
ttcccatcacacttcagctccgacctgaaggacctgttgagaaacctgctgcaggtggat
ctcaccaaacgctacggcaaccttaaaaacggagttaacgatatcaaaggacacaagtgg
ttctcaactactgactggatagccatttaccagcggagggtggaggccccgtttgtgcct
aaatgcagaggtcccggggacaccagcaacttcgatgactacgaggaagaagagatccgt
gtgtcgttcacggagaagtgtgcgaaagaatttgcagagttctag

KEGG   Sinocyclocheilus grahami: 107592581
Entry
107592581         CDS       T04918                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit alpha-like
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04020  Calcium signaling pathway
sgh04114  Oocyte meiosis
sgh04140  Autophagy - animal
sgh04261  Adrenergic signaling in cardiomyocytes
sgh04270  Vascular smooth muscle contraction
sgh04310  Wnt signaling pathway
sgh04340  Hedgehog signaling pathway
sgh04371  Apelin signaling pathway
sgh04530  Tight junction
sgh04540  Gap junction
sgh04910  Insulin signaling pathway
sgh04912  GnRH signaling pathway
sgh04914  Progesterone-mediated oocyte maturation
sgh04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107592581
   04310 Wnt signaling pathway
    107592581
   04340 Hedgehog signaling pathway
    107592581
   04371 Apelin signaling pathway
    107592581
   04020 Calcium signaling pathway
    107592581
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107592581
  09143 Cell growth and death
   04114 Oocyte meiosis
    107592581
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107592581
   04540 Gap junction
    107592581
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107592581
   04912 GnRH signaling pathway
    107592581
   04914 Progesterone-mediated oocyte maturation
    107592581
   04916 Melanogenesis
    107592581
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107592581
   04270 Vascular smooth muscle contraction
    107592581
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sgh01001]
    107592581
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sgh03019]
    107592581
   03036 Chromosome and associated proteins [BR:sgh03036]
    107592581
Enzymes [BR:sgh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     107592581
Protein kinases [BR:sgh01001]
 Serine/threonine kinases: AGC group
  PKA family
   107592581
Messenger RNA biogenesis [BR:sgh03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     107592581
Chromosome and associated proteins [BR:sgh03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    107592581
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_C
Other DBs
NCBI-GeneID: 107592581
NCBI-ProteinID: XP_016137596
UniProt: A0A672SIU0
LinkDB
Position
Unknown
AA seq 395 aa
MAQTKDPNFGQSSGTNSALQRLDTLASRFFYKYRKGHQEKGLENEGPHVSDYTVLWDATM
KEFFAQAKEDFLRKWDFQPQSTSCLDDFDRLKTLGTGSFGRVMLVKHRLLGRYYAMKILD
KEKVVKLKQIEHTLNEKKILQTVSFPFLVKLEFAFKDHSNLYMVMEYIQGGEMFSHLRRI
GRFSEQNARFYAAQIVLTFEYLHALDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVKGRT
WTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFLSDQPIQIYEKIVSGKV
RYPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKNHSWFATTDWIAIFEKKIDAPII
PKCKGPGDTSNFDEYDEEDIRLSVTEKCTKEFLEF
NT seq 1188 nt   +upstreamnt  +downstreamnt
atggcccagacaaaagatccaaactttgggcagtcatcaggcactaactctgcccttcag
aggctggacacgttagctagccgatttttttacaaatatcgaaaagggcaccaggagaag
ggactagagaatgaggggccacatgtttcagattataccgtgctttgggatgcaacaatg
aaagaattctttgcacaagccaaagaggatttcttgagaaaatgggactttcagccacag
agcacatcgtgtctagatgactttgacagattgaaaactcttggcactggatctttcgga
agagtaatgcttgtcaagcacagactgttgggacgatactacgctatgaagattctggac
aaagaaaaagtggtgaagcttaaacagatagaacacacattaaacgagaagaaaatatta
caaacagtgtcctttcctttccttgtgaagctggagttcgcttttaaggatcattcaaat
ttatacatggtcatggaatatatccaaggtggtgagatgttctcacatctgagacggatt
ggaagattcagtgagcagaacgcacggttttatgctgctcagattgttctgaccttcgag
tatcttcatgctctagacctcatctacagagaccttaaacctgaaaacttgctcatcgat
catcagggatacatccaggtaacagacttcggctttgccaaacgagtcaaaggcagaact
tggacgttatgcggtacaccagagtacctggcaccagagatcattctcagcaagggctac
aacaaagctgttgactggtgggcattgggtgttctgatctatgaaatggctgctggatat
ccgcctttcttatctgaccaacctattcagatctatgagaaaattgtatctggcaaggta
cgatacccttcacactttagttcagacctgaaggatcttctacgcaatctgctgcaggtg
gacctcacaaaacgctttggcaatttgaaaaatggagtcagcgacataaaaaaccacagc
tggttcgctacaacagactggattgcaatctttgagaagaagattgatgctcccatcata
ccaaagtgcaaaggacctggagacacaagtaactttgatgagtacgacgaggaagacatc
cggttatctgttacagagaaatgtacaaaagagttcttggagttttag

KEGG   Sinocyclocheilus grahami: 107594309
Entry
107594309         CDS       T04918                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit alpha-like
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04020  Calcium signaling pathway
sgh04114  Oocyte meiosis
sgh04140  Autophagy - animal
sgh04261  Adrenergic signaling in cardiomyocytes
sgh04270  Vascular smooth muscle contraction
sgh04310  Wnt signaling pathway
sgh04340  Hedgehog signaling pathway
sgh04371  Apelin signaling pathway
sgh04530  Tight junction
sgh04540  Gap junction
sgh04910  Insulin signaling pathway
sgh04912  GnRH signaling pathway
sgh04914  Progesterone-mediated oocyte maturation
sgh04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107594309
   04310 Wnt signaling pathway
    107594309
   04340 Hedgehog signaling pathway
    107594309
   04371 Apelin signaling pathway
    107594309
   04020 Calcium signaling pathway
    107594309
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107594309
  09143 Cell growth and death
   04114 Oocyte meiosis
    107594309
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107594309
   04540 Gap junction
    107594309
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107594309
   04912 GnRH signaling pathway
    107594309
   04914 Progesterone-mediated oocyte maturation
    107594309
   04916 Melanogenesis
    107594309
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107594309
   04270 Vascular smooth muscle contraction
    107594309
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sgh01001]
    107594309
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sgh03019]
    107594309
   03036 Chromosome and associated proteins [BR:sgh03036]
    107594309
Enzymes [BR:sgh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     107594309
Protein kinases [BR:sgh01001]
 Serine/threonine kinases: AGC group
  PKA family
   107594309
Messenger RNA biogenesis [BR:sgh03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     107594309
Chromosome and associated proteins [BR:sgh03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    107594309
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 107594309
NCBI-ProteinID: XP_016139811
LinkDB
Position
Unknown
AA seq 361 aa
MGNTPAAKRGNEMESDAHREYGRACGDGADAGMAITGSNNVGCVPQNTASLEDFERLKTL
GTGSFGRVMLVRHRESGQHYAMKILNKQKVVKLKQIEHTLNEKRILQAVSFPFLVRLEYS
FKDNTNLYMVMQYVQGGEMFSHLRRIGRFSEPHARFYASQIVLTFEYLHALDLIYRDLKP
ENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLMY
EMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLKNGVN
DIKGHKWFSTTDWIAIYQRRVEAPFVPKCRGPGDTSNFDDYEEEEIRVSFTEKCAKEFAE
F
NT seq 1086 nt   +upstreamnt  +downstreamnt
atgggcaacacgccggccgccaaacggggcaacgagatggaaagcgatgctcatcgggaa
tacggtcgtgcatgtggagatggtgctgatgctggcatggcgatcacaggctcaaacaat
gttgggtgtgtcccacagaacacagcgagtctggaggacttcgagcggctgaagactctg
ggcacgggctcattcggtcgcgtgatgctggtcaggcaccgagagagcgggcagcactac
gccatgaagatccttaacaaacagaaggtcgtgaagctgaagcagattgagcacactctc
aacgagaagcggatactgcaggccgtcagcttccccttcttagtgcggctggagtactcc
ttcaaggacaacactaatctctacatggtgatgcagtacgttcagggaggagagatgttt
tcacacctgcgtagaatcggcagattcagtgaaccccatgcgcggttttatgcttcacaa
atagtcttgacgtttgagtatctgcatgccctcgacctgatctacagagaccttaaacca
gagaacctcctcatcgatcagcagggctatatacaggtgacagactttggtttcgcgaag
cgggtcaagggtcgcacgtggacattgtgcggcaccccggagtatctggccccagagatc
atcctcagcaagggttataataaggctgtggactggtgggctctgggtgtgctgatgtac
gagatggctgccggttatcctccgttttttgccgatcaacccattcagatctacgaaaag
attgtctcaggaaaggtacggttcccgtcacacttcagctccgacctgaaggacctgttg
agaaacctgctgcaggtggacctcaccaaacgctacggcaaccttaaaaacggagttaac
gacatcaaaggtcacaagtggttctcaactactgactggatagccatttaccagcggagg
gtggaggccccgtttgtgcctaaatgcagaggtcccggggacaccagcaacttcgacgac
tacgaggaagaagagatccgtgtgtcgttcacggagaagtgcgcgaaagaatttgccgag
ttctag

KEGG   Sinocyclocheilus grahami: 107599301
Entry
107599301         CDS       T04918                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit alpha-like
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04020  Calcium signaling pathway
sgh04114  Oocyte meiosis
sgh04140  Autophagy - animal
sgh04261  Adrenergic signaling in cardiomyocytes
sgh04270  Vascular smooth muscle contraction
sgh04310  Wnt signaling pathway
sgh04340  Hedgehog signaling pathway
sgh04371  Apelin signaling pathway
sgh04530  Tight junction
sgh04540  Gap junction
sgh04910  Insulin signaling pathway
sgh04912  GnRH signaling pathway
sgh04914  Progesterone-mediated oocyte maturation
sgh04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107599301
   04310 Wnt signaling pathway
    107599301
   04340 Hedgehog signaling pathway
    107599301
   04371 Apelin signaling pathway
    107599301
   04020 Calcium signaling pathway
    107599301
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107599301
  09143 Cell growth and death
   04114 Oocyte meiosis
    107599301
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107599301
   04540 Gap junction
    107599301
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107599301
   04912 GnRH signaling pathway
    107599301
   04914 Progesterone-mediated oocyte maturation
    107599301
   04916 Melanogenesis
    107599301
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107599301
   04270 Vascular smooth muscle contraction
    107599301
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sgh01001]
    107599301
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sgh03019]
    107599301
   03036 Chromosome and associated proteins [BR:sgh03036]
    107599301
Enzymes [BR:sgh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     107599301
Protein kinases [BR:sgh01001]
 Serine/threonine kinases: AGC group
  PKA family
   107599301
Messenger RNA biogenesis [BR:sgh03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     107599301
Chromosome and associated proteins [BR:sgh03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    107599301
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 107599301
NCBI-ProteinID: XP_016146335
UniProt: A0A672LYE9
LinkDB
Position
Unknown
AA seq 352 aa
MGNAPTAKNKGNEMESVKEFLAKAKEDFLKKWENPAQNTASLDHFERLKTLGTGSFGRVM
LVKHKESGQHFAMKILDKQKVVKLKQIEHTLNEKRILQAVSFPFLVRLEHSFKDNTNLYM
VMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQG
YIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPF
FADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKGHKWFA
TTDWIAIYQKKVEAPFIPKCKGPGDTSNFDDYEEEEIRVSFTEKCGKEFAEF
NT seq 1059 nt   +upstreamnt  +downstreamnt
atgggcaacgcgcccaccgccaagaacaagggcaatgagatggagagcgttaaggagttt
cttgctaaagccaaagaagatttcctaaagaaatgggagaacccagcacagaacactgca
tctctggaccattttgagaggttgaagactctaggcactggctcatttggacgagtcatg
ctagtcaagcacaaagaatcaggccagcattttgccatgaagatcctcgataaacagaag
gtggtgaaactgaaacagatcgaacacacgctgaatgagaaacgcatcctgcaggctgtc
agtttcccgttccttgtgcgattggagcactcgttcaaggataatactaacctgtatatg
gtaatggagtatgttcctggaggagagatgttctctcacttacgtagaatcggccggttc
agtgagcctcatgcccgattctacgccgcccagatagttctgacctttgaataccttcac
tcacttgatcttatctaccgagatctgaagcctgaaaacctgctcatagaccagcagggc
tacatacaggtaacagattttggatttgctaaacgtgtaaagggcaggacctggacactg
tgtggcacacctgagtacctggcgccagaaatcatcctcagtaaaggttataataaagca
gtggactggtgggctctgggtgtgctgatctatgaaatggctgccggttaccctccgttt
tttgccgaccagcccatccagatctacgagaagattgtttctgggaaggttcgcttcccc
tcacactttagctctgacctgaaggacctgctgagaaacctgctgcaggtagatctgacg
aagcgcttcggtaacctcaagaacggcgtcaacgacatcaaaggccacaaatggtttgca
accaccgactggatcgcaatctaccagaagaaggtggaagcccccttcatacctaagtgc
aaaggccccggggacaccagcaactttgacgactacgaggaagaagaaatccgggtctct
ttcacagagaaatgtggaaaggagtttgctgaattctag

KEGG   Sinocyclocheilus grahami: 107600310
Entry
107600310         CDS       T04918                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit beta isoform X1
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04020  Calcium signaling pathway
sgh04114  Oocyte meiosis
sgh04140  Autophagy - animal
sgh04261  Adrenergic signaling in cardiomyocytes
sgh04270  Vascular smooth muscle contraction
sgh04310  Wnt signaling pathway
sgh04340  Hedgehog signaling pathway
sgh04371  Apelin signaling pathway
sgh04530  Tight junction
sgh04540  Gap junction
sgh04910  Insulin signaling pathway
sgh04912  GnRH signaling pathway
sgh04914  Progesterone-mediated oocyte maturation
sgh04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107600310
   04310 Wnt signaling pathway
    107600310
   04340 Hedgehog signaling pathway
    107600310
   04371 Apelin signaling pathway
    107600310
   04020 Calcium signaling pathway
    107600310
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107600310
  09143 Cell growth and death
   04114 Oocyte meiosis
    107600310
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107600310
   04540 Gap junction
    107600310
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107600310
   04912 GnRH signaling pathway
    107600310
   04914 Progesterone-mediated oocyte maturation
    107600310
   04916 Melanogenesis
    107600310
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107600310
   04270 Vascular smooth muscle contraction
    107600310
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sgh01001]
    107600310
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sgh03019]
    107600310
   03036 Chromosome and associated proteins [BR:sgh03036]
    107600310
Enzymes [BR:sgh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     107600310
Protein kinases [BR:sgh01001]
 Serine/threonine kinases: AGC group
  PKA family
   107600310
Messenger RNA biogenesis [BR:sgh03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     107600310
Chromosome and associated proteins [BR:sgh03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    107600310
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_C
Other DBs
NCBI-GeneID: 107600310
NCBI-ProteinID: XP_016147664
LinkDB
Position
Unknown
AA seq 354 aa
MGNAATAKKGNEVESETFVKEFLAKAKEDFLRKWESPPQSTTGLDDFDKLKTLGTGSFGR
VMLVKHKATDQFYAMKVLDKQKVVKLKQVEHTLNEKRILQAVSFPFLVRLEYAFKDNSNL
YMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQ
HGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYP
PFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLRNGVNDIKNHKW
FATTDWIAIYERKVEAPFIPKCRGPGDTSNFDDYEEEDIRVSVTEKCAKEFSEF
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgggaaacgcagcgactgccaagaaaggcaatgaagtggagagcgagacgtttgtgaaa
gagtttctagccaaagccaaagaagatttcttgagaaaatgggaatctccaccacagagc
acaactggtttagatgacttcgacaaactgaagacgttgggcacgggctcttttgggaga
gtcatgctggttaaacacaaggctacggatcagttctatgccatgaaggttctggacaaa
caaaaggtggtgaagttgaaacaagtggagcatacgctaaatgagaagagaatattacaa
gcagtatctttcccgttcctcgtcagattggaatatgccttcaaggacaactctaatttg
tatatggtgatggagtatgtaccaggaggggagatgttctcacatcttagaagaatcggg
aggtttagtgaaccacatgcacggttttatgctgctcagattgtcctgactttcgagtac
ctccactcactagacctcatctacagagacctgaaacctgaaaacctactcattgaccag
catggatatatacaggtaacagactttggttttgcaaaaagagtaaaaggcagaacctgg
actttatgtggaactccagagtacttggcaccagagatcatcctcagcaagggatacaac
aaggctgtggactggtgggcccttggtgttctcatatatgaaatggcagctggatatccc
ccattttttgcagaccagcctattcagatatatgagaaaattgtgtctggaaaggtacga
ttcccctcgcacttcagttcggatctgaaagatctgttgaggaatctgctgcaggtggac
ctgaccaagcgctacggcaacctgaggaatggtgtcaatgatatcaaaaaccacaaatgg
tttgccacaacggattggatagccatctatgagagaaaggtggaggcgccgttcatacca
aagtgccgaggtcctggagacacaagcaactttgatgactatgaagaggaagacattcgt
gtatctgttacagaaaaatgcgcaaaggagttctccgagttttag

KEGG   Sinocyclocheilus grahami: 107602709
Entry
107602709         CDS       T04918                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit alpha isoform X1
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04020  Calcium signaling pathway
sgh04114  Oocyte meiosis
sgh04140  Autophagy - animal
sgh04261  Adrenergic signaling in cardiomyocytes
sgh04270  Vascular smooth muscle contraction
sgh04310  Wnt signaling pathway
sgh04340  Hedgehog signaling pathway
sgh04371  Apelin signaling pathway
sgh04530  Tight junction
sgh04540  Gap junction
sgh04910  Insulin signaling pathway
sgh04912  GnRH signaling pathway
sgh04914  Progesterone-mediated oocyte maturation
sgh04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107602709
   04310 Wnt signaling pathway
    107602709
   04340 Hedgehog signaling pathway
    107602709
   04371 Apelin signaling pathway
    107602709
   04020 Calcium signaling pathway
    107602709
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107602709
  09143 Cell growth and death
   04114 Oocyte meiosis
    107602709
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107602709
   04540 Gap junction
    107602709
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107602709
   04912 GnRH signaling pathway
    107602709
   04914 Progesterone-mediated oocyte maturation
    107602709
   04916 Melanogenesis
    107602709
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107602709
   04270 Vascular smooth muscle contraction
    107602709
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sgh01001]
    107602709
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sgh03019]
    107602709
   03036 Chromosome and associated proteins [BR:sgh03036]
    107602709
Enzymes [BR:sgh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     107602709
Protein kinases [BR:sgh01001]
 Serine/threonine kinases: AGC group
  PKA family
   107602709
Messenger RNA biogenesis [BR:sgh03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     107602709
Chromosome and associated proteins [BR:sgh03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    107602709
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 107602709
NCBI-ProteinID: XP_016150762
UniProt: A0A672P9B8
LinkDB
Position
Unknown
AA seq 383 aa
MCDRKSSKKHGGKRESRSSGGSVEGGGGGSSSGGGEGGVEGPTLLVDVKEFLAKAKEDFL
KKWENPAQNTASLDHFERLKTLGTGSFGRVMLVKHKESGQHFAMKILDKQKVVKLKQIEH
TLNEKRILQAVSFPFLVRLEHSFKDNTNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYA
AQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAP
EIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKD
LLRNLLQVDLTKRFGNLKNGVNDIKGHKWFATTDWIAIYQKKVEAPFIPKCKGPGDTSNF
DDYEEEEIRVSFSEKCGKEFAEF
NT seq 1152 nt   +upstreamnt  +downstreamnt
atgtgtgaccgaaaaagctcaaagaagcatggtgggaagcgggaatctcgttcttcagga
ggatcagtggagggaggagggggaggtagtagtagtggtggtggtgaaggaggagtggag
ggtcccacgctcctagtggacgttaaggagtttcttgctaaagccaaagaagatttccta
aagaaatgggagaacccagcacagaatactgcatctctggaccattttgagaggttgaag
actctaggcactggctcgtttggacgagtcatgctagtcaagcacaaagagtcaggccag
cattttgccatgaagatcctcgacaaacagaaggtggtgaaactgaaacagatagaacac
acactgaacgagaaacgtatcctgcaggccgtcagcttcccgttccttgtgcgattggag
cactcgttcaaggacaatactaacctgtatatggtaatggagtatgttcctggaggagag
atgttctctcacttacgtagaatcggccggtttagtgagcctcatgcccgattctacgcc
gcccagatagttctgacctttgaataccttcactcacttgatctaatctaccgagatctg
aagcctgaaaacctgctcatagaccagcagggctacatacaggtaacagattttggattt
gctaaacgtgtaaagggcaggacctggacactgtgtggcacacccgagtacctggcgcca
gaaatcatcctcagtaaaggttataataaagcagtggactggtgggctctgggagtgctg
atctatgaaatggctgccggttaccctccgttctttgccgaccagcccatccagatctac
gagaagattgtttctgggaaggttcgcttcccctcacattttagctctgacctgaaggac
ctgctgaggaacctgctacaggtagatctgacgaagcgcttcggtaacctcaagaacggt
gtcaacgacatcaagggccacaaatggtttgcaaccaccgactggatcgcaatctaccag
aagaaggtggaagcccccttcatccctaagtgcaaaggccccggtgacaccagcaacttt
gacgactacgaggaagaagaaatccgggtctctttctcagagaaatgtggaaaggagttt
gctgaattctag

DBGET integrated database retrieval system