KEGG   Sinocyclocheilus grahami: 107560608
Entry
107560608         CDS       T04918                                 

Definition
(RefSeq) lysophosphatidic acid receptor 1-like isoform X1
  KO
K04291  lysophosphatidic acid receptor 2
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04080  Neuroactive ligand-receptor interaction
sgh04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107560608
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107560608
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:sgh04030]
    107560608
G protein-coupled receptors [BR:sgh04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    107560608
SSDB
Motif
Pfam: 7tm_1 7tm_4
Other DBs
NCBI-GeneID: 107560608
NCBI-ProteinID: XP_016100320
UniProt: A0A672Q700
LinkDB
Position
Unknown
AA seq 370 aa
MVCHDNESVKFFYDISKKNISETWQTKDLVVVSLGLLVCSFVIFANILVMLAIFMNRRFH
YPIYYLLGNLAAADLFAGVSYMYLMFHTGPWTSKLSIGQWFVRQGLIDTSLTASVINLMA
IALERHQTIFTMQLHSKMTNHRVVLLIIGIWLIAIVLGLVPSMGWSCVCNTMECSNMAPL
YSRSYLVFWAVLNLLTFTIMVAVYTRIFIYVHRKSHRMSQHTSQIKHKETVVNLMKTVVM
ILGCFVVCWTPGLVLLLLDGSCESCDVLTYEKFFLVLAECNSFMNPIIYSYRDKDMRDTF
KRILCFPCVGSQQEGEHSGAHFNTLEQERRRRVLQESWVARRARDGDGAPANGGRLVLKE
AENMLDSTES
NT seq 1113 nt   +upstreamnt  +downstreamnt
atggtttgccatgacaacgagagcgtgaagttcttctacgacatcagcaagaagaatatc
agcgaaacgtggcagactaaagacttagtggtggtttctctgggcctgctggtctgttct
ttcgtcatcttcgccaacatcctggtcatgctggccatcttcatgaaccgcaggttccac
taccccatctactacctgctggggaacctggcggcggccgacctgttcgccggcgtctcc
tacatgtacctgatgttccacacgggcccctggaccagcaagctctccatcggtcagtgg
tttgtgcggcagggtttgatcgacaccagtctgacggcatcggtcattaatctgatggcc
atcgcgctggagcgccaccagaccattttcaccatgcagctgcacagcaaaatgaccaac
caccgggtggtgctgctgatcatcggcatctggctcatcgccatagtgctgggtttggtg
ccctctatgggatggagctgcgtgtgcaacaccatggagtgctcaaacatggcaccgctc
tacagccgcagctacctggtgttctgggccgtgctcaacctgctgaccttcaccatcatg
gtggctgtctacacgcgcatcttcatctacgtgcaccgcaagagccaccgcatgagccag
cacacctcgcagatcaagcacaaggagacggtggtcaacctgatgaagaccgtcgtcatg
atcctgggttgtttcgtggtgtgttggacgccggggctggttctgcttctcctggacggt
tcgtgtgagtcctgcgacgtcctgacctacgagaagttcttcctggtgctggccgagtgc
aactccttcatgaaccccatcatctactcctaccgcgacaaggacatgcgcgacaccttc
aagcgcatcctctgcttcccgtgtgtggggtcgcagcaggagggcgagcactcgggcgcg
cacttcaacaccctcgagcaagagcggagacggcgcgtgctgcaggagtcatgggttgct
cgtagggctcgtgatggagacggcgcgccggctaacggaggacggctcgtgctgaaggag
gcggagaacatgctggactccactgagagctga

DBGET integrated database retrieval system