KEGG   Sinocyclocheilus grahami: 107560746
Entry
107560746         CDS       T04918                                 

Gene name
stat3
Definition
(RefSeq) signal transducer and activator of transcription 3
  KO
K04692  signal transducer and activator of transcription 3
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04068  FoxO signaling pathway
sgh04217  Necroptosis
sgh04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    107560746 (stat3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107560746 (stat3)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    107560746 (stat3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sgh03000]
    107560746 (stat3)
Transcription factors [BR:sgh03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    107560746 (stat3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 Spectrin
Other DBs
NCBI-GeneID: 107560746
NCBI-ProteinID: XP_016100489
LinkDB
Position
Unknown
AA seq 721 aa
MASQVAVRFVDNVNMAQWNQLQQLETRYLEQLYHLYSDSFPMELRQFLAPWIESQDWAYA
ANKESHATLVFHNLLGEIDQQYSRFLQENNVLYQHNLRRIKQHLQSKYLEKPMEIARIVA
RCLWEEQRLLQTATTAQQDGQVAHPTGTVVTEKQQILEHNLQDIRKRVQDMEQKMKMLEN
LQDDFDFNYKTLKSAGELSQDLNGNSQAAATRQKMSQLEQMLSALDQLRRQIVTEMAGLL
SAMDFVQKNLTDEELADWKRRQQIACIGGPPNICLDRLETWITSLAESQLQIRQQIKKLE
ELQQKVSYKGDPIIQHRPALEEKIVDLFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQF
TTKVRLLVKFPELNYQLKIKVCIDKESGDVAAIRGSRKFNILGTNTKVMNMEESNNGSLS
AEFKHLTLREQRCGNGGRTNSDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVIS
NICQMPNAWASILWYNMLTNHPKNVNFFTKPPVGTWDQVAEVVSWQFSSTTKRGLTIEQL
TTLAEKLLGPCVNYSGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYI
MGFISKERERAILSPKPPGTFLLRFSESSKEGGITFTWVEKDINGKTQIQSVEPYTKQQL
NSMSFAEIIMGYKIMDATNILVSPLVYLYPDIPKEEAFGKYCRPEAHPDTEFPDPGCVVQ
P
NT seq 2166 nt   +upstreamnt  +downstreamnt
atggccagtcaagttgcagtccgttttgtggataatgtcaacatggcccagtggaatcag
ttacagcagttggagacgcggtatctggagcagctgtatcacctgtacagtgacagcttt
cctatggagctgaggcagttcttggccccctggattgagagccaggactgggcgtatgcg
gccaacaaggagtctcacgccacgcttgtgttccataacctgctgggggagatcgatcag
cagtacagccgcttcctgcaggagaacaatgtcctgtaccaacacaacctgcggcgcatt
aaacagcatctgcagagcaagtatctggagaagcccatggagatcgcccgcatcgtggcc
cgctgcttgtgggaagagcagcgtctgctgcagacggccaccactgcacagcaggatggc
caggttgcccatcccactggcactgtggtgacagaaaaacagcagatactagaacacaac
ctgcaggatattaggaagagagtacaggatatggagcagaagatgaagatgttagaaaat
ctgcaagatgattttgacttcaactacaaaactcttaaaagtgctggagagttgtcccag
gacctgaatggaaacagtcaggcagcagccaccaggcagaagatgtctcagcttgagcag
atgctgagcgctctggatcagctgaggaggcaaatagtgactgagatggcagggttgctg
tctgccatggactttgtgcagaagaatctgacagatgaagaactggctgactggaagagg
aggcagcagatcgcttgcattggaggaccaccgaacatctgcctggaccgcttagagaca
tggatcacctctttggctgagtcgcagttgcagataagacagcagatcaagaaactggag
gagcttcaacagaaggtctcatacaaaggagatccgattattcaacaccgcccagctctg
gaggagaagattgtagacctgttccgcaacctcatgaagagtgcatttgttgttgagagg
cagccttgtatgcccatgcaccctgaccgaccacttgtcatcaaaacaggagttcagttc
accaccaaagtcaggttacttgtgaaattcccagagttgaactaccagctgaaaatcaaa
gtgtgtattgacaaggagtcaggtgacgtggcagccattcgaggttcacgaaagttcaac
atccttggcaccaacacgaaggtgatgaacatggaggaatccaacaatggcagcctgtca
gcagagttcaaacatctgactcttcgagagcagagatgtggcaatggaggccgaaccaac
agtgatgcgtctctgatagtgaccgaagaactgcacctgatcacatttgagacagaagtc
taccaccaaggactaaagatcgaccttgagacacattctctcccagtggtggtcatctct
aatatctgtcaaatgccaaatgcatgggcgtccatcctgtggtacaacatgctgaccaac
catcccaagaatgtgaatttcttcaccaaacctccagtaggaacgtgggatcaggtagct
gaggtggtcagctggcagttttcatccacaaccaagagaggacttaccattgagcagctc
accacacttgcagagaaacttctgggtccttgtgtaaactactctggttgccagataaca
tgggccaagttctgcaaagagaacatggcaggaaaaggtttctcattctgggtgtggcta
gacaacattatcgacctagtgaagaaatatattttggctctatggaatgaaggatatatt
atgggcttcatcagtaaagaaagagagagggcaatcctgagcccaaagcctcctgggaca
ttcctgctgcgcttcagtgaaagcagcaaagagggaggcattaccttcacctgggttgag
aaggacatcaatggtaagacccagatccagtcggttgaaccgtacactaagcagcagctc
aacagcatgtctttcgccgagatcattatgggctacaagatcatggatgccaccaacatc
ctggtctcgccgctggtctacctctaccctgatatccccaaagaggaggcgtttggcaag
tactgccgccctgaggcccatcctgataccgaattccctgatcctggatgtgtagttcag
ccttaa

DBGET integrated database retrieval system