KEGG   Sinocyclocheilus grahami: 107560912
Entry
107560912         CDS       T04918                                 

Definition
(RefSeq) NF-kappa-B essential modulator-like isoform X1
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04210  Apoptosis
sgh04620  Toll-like receptor signaling pathway
sgh04621  NOD-like receptor signaling pathway
sgh04622  RIG-I-like receptor signaling pathway
sgh04623  Cytosolic DNA-sensing pathway
sgh04625  C-type lectin receptor signaling pathway
sgh04920  Adipocytokine signaling pathway
sgh05132  Salmonella infection
sgh05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107560912
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107560912
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107560912
   04621 NOD-like receptor signaling pathway
    107560912
   04622 RIG-I-like receptor signaling pathway
    107560912
   04623 Cytosolic DNA-sensing pathway
    107560912
   04625 C-type lectin receptor signaling pathway
    107560912
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    107560912
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107560912
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107560912
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sgh01001]
    107560912
Protein kinases [BR:sgh01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   107560912
SSDB
Motif
Pfam: NEMO CC2-LZ DUF1241 DHR10 DUF1216 Cas_GSU0053
Other DBs
NCBI-GeneID: 107560912
NCBI-ProteinID: XP_016100693
LinkDB
Position
Unknown
AA seq 528 aa
MVQPQPSGGCTLQWELTGEETVGARGQGSLMASSQGSMGVPPELAGNEVVHRLVTDNHQL
REALKRSNDALKERCDEMEGWQRRSREEREFLSCRFREARALVQRLAQENQSLLGQLNHS
ISQTGSPSVGISKETGNQGQDQELKCTNVEKNVLMDSPEVLNEAVLTDRAEGDADRHTMP
QSLPVEGSNEFLKLLKSHKEKLEEGMRALRRRNEELEKEKTENEKERENLLTTVEKLRSK
LNQNGGVTEESVQQACALTVPAESSHLAKLTEQLQATQGRYRELQEKLDCLQKSSVQRDR
NEALLKQKEKDFVQLTKDSEALRAQVTSLLGELNERQNWLEKSEAERRILEDKLGKKTER
LQTLERDMEQQKKQHSVTVDNLLLQTQNLETALKNERLVIVEERRKLAQLQHAYTCLFQD
YDKKLKSEKQANHRCGEADTLVNRLAEAEKALALKQDLIDKLKEETEQLRAALETIPVLN
AQAEIYKMDFLAEREAREKLNQKKEELQEELSKALVEIDRLKQEGTSR
NT seq 1587 nt   +upstreamnt  +downstreamnt
atggtccagccgcagccgtcaggtggttgtactctgcagtgggagctgactggagaggag
actgtgggtgccaggggtcaagggtcactgatggccagttcacaggggtctatgggggtc
cctcctgaattagcgggaaatgaagtggtccatagactcgtaacagataatcatcagcta
cgagaggctctgaagcgaagcaatgatgccctcaaagaaagatgtgatgagatggagggg
tggcagaggaggtcgagagaggagcgcgagttcctgagctgtagatttcgtgaggccaga
gctttagtgcagcgactggcacaggaaaaccagagcctgttgggacagctcaaccacagc
atcagtcaaacagggagtccaagtgttggcatctctaaagagactggaaatcaaggccag
gaccaagagctgaagtgcactaatgtagagaagaatgtcctcatggactcgccagaagta
ttaaatgaagctgtactgacagaccgagctgaaggagacgctgacagacacacaatgcct
caaagtttgcctgttgagggctctaatgaatttctgaaactgctgaaaagccacaaagag
aagctagaggaagggatgagggcactgaggaggaggaatgaggagctggagaaggagaag
acagagaatgagaaagagagagaaaatctcctcaccactgtagagaagttacgctccaaa
ctcaatcagaatggtggtgttactgaagagtcagtccagcaggcatgcgcgctcaccgtt
cctgcagaaagctctcacttggctaaactaactgagcagcttcaggctacacaaggcagg
tacagggagctccaggagaagctggactgtcttcagaagagctctgttcagagagacaga
aatgaggctctactcaaacagaaggagaaggactttgttcagctgacaaaggatagtgaa
gctctgagagctcaggtcacgtcccttctcggtgagttgaatgaacgacaaaattggctg
gagaaaagtgaagcagagagacgaattttagaggataagttgggcaagaagaccgaacgc
ctgcagactttagagagagacatggagcagcagaagaagcagcacagtgtgacagtggac
aatcttttactgcagacacagaacctagaaactgcactgaagaacgagaggctcgtcata
gtggaggagaggaggaagctggcccagctccaacatgcgtacacatgtttgtttcaggat
tatgacaaaaaactcaaaagtgaaaagcaagccaatcacaggtgtggcgaggcagatact
ctagttaacaggttagcagaggctgagaaagctctggctctgaaacaggatctcattgat
aaactcaaggaggaaacggagcagctgagagctgcattagagactataccagtgctgaac
gctcaggcagagatctataagatggacttcctggctgagagggaagccagagagaaactc
aatcaaaagaaggaagagttgcaggaggagctgagtaaggcactagttgagatagacaga
ctcaagcaagaaggaacctcaaggtag

DBGET integrated database retrieval system