KEGG   Sinocyclocheilus grahami: 107560990
Entry
107560990         CDS       T04918                                 

Definition
(RefSeq) fos-related antigen 1-like
  KO
K04502  fos-like antigen 1
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107560990
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sgh03000]
    107560990
Transcription factors [BR:sgh03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    107560990
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf Macoilin Prefoldin_2 HALZ BST2 Spc24 RRF
Other DBs
NCBI-GeneID: 107560990
NCBI-ProteinID: XP_016100804
LinkDB
Position
Unknown
AA seq 352 aa
MYNYGSLGSGIDRTFPDNSSGSGSSSATPATTTVTTQQQQKYSVAGSSQFVPSLNAITSN
QDLQWMLQPSVLGTPGHSRALRPSYSLPPRIPYMNPQLSQSHMPRPGVIRAATAVGSSTR
SRNDEHLSPEELERRRIRRERNKMAAAKCRNRRRELTDTLQNQTDQLEDEKSRLQKEIAE
LQKQKEKFELVFEAHRPICKVQDSDSDSDSNSDLLTLSGIKIESVDPDLPGPSRESKSHA
KPYKPKPKITIPPPASASTGTSVPLESESLHTPVLISTPSLTPFTASLVFSYPSSSQDTS
SATSSQALNLTSSHSTSQSSHNPQPCGVAHRRSSSSGDQSDHSLNSPTILSL
NT seq 1059 nt   +upstreamnt  +downstreamnt
atgtacaactacggaagcctgggcagtggaatcgatcggaccttcccagataacagctct
ggatcaggctcgagctctgcgactcccgctacaaccactgtcaccactcaacaacaacag
aaatattctgtggcaggatccagtcagtttgtgcccagtctcaatgccataacttcaaac
caggaccttcaatggatgcttcagccctccgttctaggcaccccgggacattccagggca
cttcgaccatcttactcactgccaccaagaatcccatatatgaatcctcaactttcccaa
tcacacatgccccggccaggtgttattagagcagctacagccgttggcagctcaacaaga
agtagaaatgatgaacatctatcccctgaggaacttgagcggcgtagaattagaagagaa
cgtaacaaaatggctgcggcaaagtgcaggaatcgtcgacgtgaactgactgacacatta
caaaatcaaactgaccagctagaggatgaaaaatcacgtctgcagaaggagatcgctgag
cttcagaagcaaaaagagaagtttgagttggtctttgaagcccatagacccatctgcaaa
gtccaggactcggactcagactctgactccaacagtgacctcctgacactgagtggaatc
aagatcgagtctgtggaccctgatcttcctggaccctccagagaatcaaagagtcacgcc
aagccttataaaccgaagcccaaaattaccataccacctccagcttcagcctccactggt
accagcgtacctctggaatcagagtctcttcatactcctgtcctcatctccactccatct
ctgaccccttttactgccagcctggtctttagctacccctcttcttcacaggataccagc
tctgcgacttcatcccaagctctcaatctcaccagctctcatagtaccagccagtcttct
cataaccctcagccgtgtggcgtcgctcatcgccgcagcagcagcagtggagatcagtcg
gatcactctctcaattcaccaaccatcctcagcctttaa

DBGET integrated database retrieval system