KEGG   Sinocyclocheilus grahami: 107563223
Entry
107563223         CDS       T04918                                 

Gene name
amdhd2
Definition
(RefSeq) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh00520  Amino sugar and nucleotide sugar metabolism
sgh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    107563223 (amdhd2)
Enzymes [BR:sgh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     107563223 (amdhd2)
SSDB
Motif
Pfam: Amidohydro_1 Amidohydro_3
Other DBs
NCBI-GeneID: 107563223
NCBI-ProteinID: XP_016103521
LinkDB
Position
Unknown
AA seq 412 aa
MTQDKQKYCCNNKSVSDAPITQFVNCRILKNHRLQWEDLWVREGKILNPEKLFFDEEGFA
DHKVDCGNKIIAPGFIDVQINGGYGIDFSQASGDIRRGVAQVAKKILEHGVTSFCPTLVT
SPPDIYHKVIPELRVQDGGPEGAGVLGIHLEGPFISEQKRGAHPPKFLRTLKAGGVADLM
ETYGHLDNVAMVTLAPELANSAAAIRELSGRGIAVSLGHSMADLSQAEEAVQNGAMFITH
LFNAMLPFHHRDPGIVGLLTSDRIPPGRMVYYGMIADGIHTHPAALRIAHRAHPAGLVLV
TDAVTAMGLPPGQHTLGQQQIDIQGLHAYVAGTTTLSGSIATMDMCVRHFREVSGCTVEA
ALEAASLHPAQLLGISHRKGTLEYGTDADFVVLDDTLTVRETYIAGQQVWRK
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgacgcaggataagcaaaaatactgttgtaacaataagagtgtctcagatgccccgatc
acacagtttgtgaactgcaggatactgaagaaccacagactgcaatgggaagacctgtgg
gtccgcgagggcaagattctgaacccagagaagctgtttttcgatgaagagggttttgca
gatcacaaagttgactgcgggaataaaatcattgcacctggattcatagatgtacagata
aatggtggatatggcatcgacttctcccaggccagtggtgacatcagaagaggcgtggct
caggtggccaaaaagattctagaacacggtgtcacttccttctgcccgaccctggtcacg
tctccaccggacatataccataaggtcattcctgagctcagagttcaggatggaggacct
gaaggggcaggcgttttaggtattcatctggaggggccgttcatcagtgaacagaagaga
ggagctcaccctcctaagttcctccgcactttaaaagcggggggcgtggccgacctgatg
gagacttatgggcacctagacaacgtcgccatggtgaccctcgcaccagaactagccaat
agcgcggctgcaattcgtgaactgtcaggaagaggcatagcggtgtcacttggtcactct
atggctgatctctctcaggctgaagaggctgtgcagaatggagccatgttcattacacac
ttatttaatgccatgctgccttttcatcacagagacccgggcattgtgggattgcttaca
agtgatcgtattccaccaggtcggatggtttactacggtatgatcgcagacgggatacac
acacaccctgcagcgctgcgcatcgcacacagagctcatcctgctgggttggtgttggtc
actgacgctgtgacagcgatgggtctgcctcctggtcaacacacactcggacagcagcag
attgacatccaggggcttcacgcttatgtcgcaggcactacaactttgagtggcagcatt
gcgaccatggacatgtgtgtgagacacttcagagaggtgtcaggctgtacagtagaagct
gcattagaagctgcatcgctgcatcctgctcagctgctgggtatcagtcacaggaaggga
acgctggagtacggcactgatgcagatttcgtagtgcttgatgacacactgacagtcagg
gaaacctacattgctggacagcaggtctggaggaagtga

DBGET integrated database retrieval system