KEGG   Sinocyclocheilus grahami: 107563389
Entry
107563389         CDS       T04918                                 

Definition
(RefSeq) transcription factor AP-1-like isoform X1
  KO
K04448  transcription factor AP-1
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04012  ErbB signaling pathway
sgh04137  Mitophagy - animal
sgh04210  Apoptosis
sgh04310  Wnt signaling pathway
sgh04510  Focal adhesion
sgh04530  Tight junction
sgh04620  Toll-like receptor signaling pathway
sgh04621  NOD-like receptor signaling pathway
sgh04625  C-type lectin receptor signaling pathway
sgh04912  GnRH signaling pathway
sgh05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107563389
   04012 ErbB signaling pathway
    107563389
   04310 Wnt signaling pathway
    107563389
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    107563389
  09143 Cell growth and death
   04210 Apoptosis
    107563389
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107563389
   04530 Tight junction
    107563389
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107563389
   04621 NOD-like receptor signaling pathway
    107563389
   04625 C-type lectin receptor signaling pathway
    107563389
  09152 Endocrine system
   04912 GnRH signaling pathway
    107563389
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107563389
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sgh03000]
    107563389
Transcription factors [BR:sgh03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    107563389
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_Maf bZIP_2 PspA_IM30 Paralemmin Jnk-SapK_ap_N DUF4407 Seryl_tRNA_N DUF3450 ZapB
Other DBs
NCBI-GeneID: 107563389
NCBI-ProteinID: XP_016103734
UniProt: A0A672RIT0
LinkDB
Position
Unknown
AA seq 323 aa
MTGKMETPFYHDDSVPNFGQIPDYDRYQGHKIMSKKNNMPHHFSHSVGNASSLKLNSPSG
LGMSGNPNGSLMSSPDMNLLKLSSPDLEHLIIQSNQGLVTTSPAPNASANPFMYRNQATN
EQEGFADGFVQALADLHKQNQLVGAPMSPSSSIQGSYQRNLMPGADMPIYTNLSSYNPNQ
LPSSYPGGQMAYASPHGPQTRGRDAPQTVPEVPHLPGADPASSPPSLSPINLETQERIKA
ERKKLRNRIAASKCRKRKLERISRLEEKVKVLKTQNSDLASTASILREQVAQLKQKVMNH
VTNGCQIAVSSAGMAKSGESTSC
NT seq 972 nt   +upstreamnt  +downstreamnt
atgacgggtaagatggaaacgcccttctatcacgatgatagcgttcccaactttgggcaa
attccagattacgatcgataccaaggccacaagattatgagcaagaagaacaacatgccg
catcatttctcccacagcgtgggaaacgcttcgagcctcaaactcaacagccccagcggt
ctgggcatgagcggcaatcccaacggctcgctgatgtcttctccagacatgaacctcctg
aagctgtcctctccggatctggagcacctgattatccagtctaaccagggactggttact
acaagcccggctccaaacgcgtctgctaatcccttcatgtaccgaaaccaggccacgaac
gagcaggagggattcgcagacggcttcgtccaagctctggccgatctgcacaagcagaac
cagctggtgggggcccccatgtcgccctcctcctccatccagggctcctaccaaaggaac
ctgatgccgggcgcagacatgcccatctacaccaacctgagcagctacaaccccaaccag
ctgccctcctcttaccccggcggccagatggcctacgcctcgccccacggccctcagacc
cggggccgggacgctccgcagacggtgcctgaggtccctcacctgcccggggccgacccg
gccagctccccgccctcgctctctcccatcaacctggagacccaggagcggatcaaggcg
gagcgcaagaagctgcggaaccgcatcgccgcctccaagtgccgcaagaggaagctggag
aggatctcgcggctggaggagaaggtcaaggtgctgaagacgcagaactcggacctggcc
tccaccgccagcatcctgagagagcaggtggctcagctcaaacagaaagtcatgaatcac
gtcactaatggctgccagatcgccgtcagctcagccggcatggccaagagcggcgagagc
accagctgctga

KEGG   Sinocyclocheilus grahami: 107581481
Entry
107581481         CDS       T04918                                 

Definition
(RefSeq) transcription factor AP-1-like
  KO
K04448  transcription factor AP-1
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04012  ErbB signaling pathway
sgh04137  Mitophagy - animal
sgh04210  Apoptosis
sgh04310  Wnt signaling pathway
sgh04510  Focal adhesion
sgh04530  Tight junction
sgh04620  Toll-like receptor signaling pathway
sgh04621  NOD-like receptor signaling pathway
sgh04625  C-type lectin receptor signaling pathway
sgh04912  GnRH signaling pathway
sgh05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107581481
   04012 ErbB signaling pathway
    107581481
   04310 Wnt signaling pathway
    107581481
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    107581481
  09143 Cell growth and death
   04210 Apoptosis
    107581481
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107581481
   04530 Tight junction
    107581481
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107581481
   04621 NOD-like receptor signaling pathway
    107581481
   04625 C-type lectin receptor signaling pathway
    107581481
  09152 Endocrine system
   04912 GnRH signaling pathway
    107581481
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107581481
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sgh03000]
    107581481
Transcription factors [BR:sgh03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    107581481
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_Maf bZIP_2 PspA_IM30 ZapB Fib_alpha FlaC_arch DUF3450 Jnk-SapK_ap_N NAM-associated TEX13
Other DBs
NCBI-GeneID: 107581481
NCBI-ProteinID: XP_016122545
LinkDB
Position
Unknown
AA seq 301 aa
METTFYDDSINSAFSQHVSATFGYNHKALKHNMTLNLTDPAGNLKPHLRAKANDILTSPD
VGLLKLASPELERLIIQSSNGLITTTPTPTQFLCPRNVTDEQEGFADGFVRALAELHHQH
MPSVTSAPQTTINNSMAPVSSMAGGAVYSSSMRSDPPVYADLNTFNPAISTANPAMNYTS
APPQHTVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRVAASKCR
KRKLERISRLEDKVKNLKSQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQT
F
NT seq 906 nt   +upstreamnt  +downstreamnt
atggaaactactttctacgatgactctataaacagcgctttctctcagcatgtcagcgct
acttttggatataaccataaggctctgaaacacaacatgacgctgaatctgaccgaccca
gccggcaacctgaagccccacctgagggccaaagccaacgacatcctcacctcccccgac
gtggggctgctcaaactggcttcgccggagctggagcggctcatcatccagtccagcaac
ggcctgatcactacaacgccgactccgacccagtttctgtgtcccaggaacgtgacggac
gaacaggagggcttcgcggatggcttcgtgagggcactggccgagctgcatcaccagcac
atgcccagcgtcacctcggctccccagacgaccatcaacaacagcatggcacccgtttcg
tccatggcaggcggcgcggtgtacagttcctccatgcgctccgaccctccagtgtacgcg
gacctgaacactttcaaccccgctatcagcaccgccaaccccgcgatgaactacaccagc
gccccgccgcagcacaccgtccagcacccgcggcttcaggcgctgaaggaggagccgcaa
acggtacccgagatgcccggcgagaccccacctctctcccccatcgacatggagagccag
gagcggattaaagccgagagaaagcgcatgaggaaccgggtcgccgcgtccaaatgccgg
aagaggaaactggagaggatctcccggctggaggataaagtcaagaacctgaagtcccag
aactccgagctggcgtccaccgcaaacatgctgcgcgaacaagtggcccagctcaagcag
aaagtcatgaaccacgtcaacagcggctgccagcttatgttgacgcaacagctgcagacg
ttctga

KEGG   Sinocyclocheilus grahami: 107597804
Entry
107597804         CDS       T04918                                 

Definition
(RefSeq) transcription factor AP-1-like
  KO
K04448  transcription factor AP-1
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04012  ErbB signaling pathway
sgh04137  Mitophagy - animal
sgh04210  Apoptosis
sgh04310  Wnt signaling pathway
sgh04510  Focal adhesion
sgh04530  Tight junction
sgh04620  Toll-like receptor signaling pathway
sgh04621  NOD-like receptor signaling pathway
sgh04625  C-type lectin receptor signaling pathway
sgh04912  GnRH signaling pathway
sgh05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107597804
   04012 ErbB signaling pathway
    107597804
   04310 Wnt signaling pathway
    107597804
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    107597804
  09143 Cell growth and death
   04210 Apoptosis
    107597804
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107597804
   04530 Tight junction
    107597804
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107597804
   04621 NOD-like receptor signaling pathway
    107597804
   04625 C-type lectin receptor signaling pathway
    107597804
  09152 Endocrine system
   04912 GnRH signaling pathway
    107597804
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107597804
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sgh03000]
    107597804
Transcription factors [BR:sgh03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    107597804
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_Maf bZIP_2 PspA_IM30 Fib_alpha ZapB FlaC_arch Jnk-SapK_ap_N Paralemmin TEX13 DUF1664
Other DBs
NCBI-GeneID: 107597804
NCBI-ProteinID: XP_016144480
LinkDB
Position
Unknown
AA seq 307 aa
METTFYDDSLNGAFSQHVSATFGYNHKALKHNMTLNLTDPAGNLKPHLRAKANDILTSPD
VGLLKLASPELEPLISQSSNGLITTTPTPTQFLCPRNVTDEQEGFADGFVRALAELHHQH
MPNVPPAPRTTINNSMAPVSSMAGGAVYSSSMRSDPPVYADLNTFNPAISTTNPAMNYTS
APPQHTVNTQLPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRLRNRV
AASKCRKRKLERISRLEDKVKTLKSQNSELASTANMLREQVAQLKQKVMNHVNSGCQLML
TQQLQTF
NT seq 924 nt   +upstreamnt  +downstreamnt
atggaaactactttctacgatgactctctaaacggcgctttctctcagcatgtcagcgcc
acttttggatacaaccacaaggctctgaaacacaacatgacgctgaatctgaccgacccc
gccggcaacctgaagccccacctgagggccaaagccaacgacatcctcacctcccccgac
gtggggctgctcaaactggcttcgccggagctggagccgctcatcagccagtccagcaac
ggcctgatcactacaacgccgactccgacccagtttctgtgtcccaggaacgtgacggac
gagcaggagggcttcgcggatggcttcgtgagggcactggccgagctgcatcaccagcac
atgcccaacgtcccgccggctccccgaaccaccatcaacaacagcatggcacccgtttcg
tccatggcaggtggcgcggtgtacagttcatccatgcgctccgacccgcccgtgtacgcg
gacctgaacactttcaaccccgccatcagcaccaccaacccagcgatgaactacaccagc
gccccgccgcagcacaccgtgaacacgcagctgcccgtccagcacccgcggcttcaggcg
ctgaaagaggagccccagacggtgcccgagatgcccggcgagaccccacctctctccccc
atcgacatggagagccaggagcggattaaagccgagagaaagcggttgaggaaccgagtc
gccgcgtccaaatgccggaagaggaaactggagaggatctcccggctggaggataaagtc
aagaccctgaagtcccagaactccgagctggcgtccaccgcaaacatgctgcgcgagcaa
gtggcccagctcaagcagaaagtcatgaaccacgtcaacagcggctgccagcttatgttg
acgcaacagctgcagacgttctga

DBGET integrated database retrieval system