KEGG   Sinocyclocheilus grahami: 107563631Help
Entry
107563631         CDS       T04918                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, muscle type-like
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh00010  Glycolysis / Gluconeogenesis
sgh00030  Pentose phosphate pathway
sgh00051  Fructose and mannose metabolism
sgh00052  Galactose metabolism
sgh01100  Metabolic pathways
sgh01200  Carbon metabolism
sgh01230  Biosynthesis of amino acids
sgh03018  RNA degradation
Module
sgh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107563631
   00030 Pentose phosphate pathway
    107563631
   00051 Fructose and mannose metabolism
    107563631
   00052 Galactose metabolism
    107563631
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    107563631
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sgh01009]
    107563631
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sgh03019]
    107563631
Enzymes [BR:sgh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     107563631
Protein phosphatases and associated proteins [BR:sgh01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107563631
Messenger RNA biogenesis [BR:sgh03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     107563631
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 107563631
NCBI-ProteinID: XP_016104032
LinkDB All DBs
Position
Unknown
AA seq 784 aa AA seqDB search
MANINTAGVDPTKMGVGRAIAVLTSGGDAQGMNAAVRATVRVGLYTGAKVFFVHEGYQGL
VDGGNHIRPATWESVSMMLQLGGTVIGSARCKDFQTREGRLKAAYNLVKLGVTNLCVIGG
DGSLTGANIFRTEWSDLLKDLISKGKIKNEEAKASSHLNIVGMVGSIDNDFCGTDMTIGT
DSALHRIIEVVDSITTTAQSHQRAFILEVMGRHCGYLALVTALACGADWVFIPEMPPDDG
WEDHLCRRLTETRNAGSRLNVIIVAEGAINKDGKPITCDQLKDLVTKSLGFDTRATILGH
VQRGGTPSAFDRVLGSRMGVEAVMALLEATPETPACVVSLSGNQAVRLPLMECVQVTKDV
TVAMNEGRFDDAIKLRGRSFENNWNTYKLLAHVRPPETKSNINVAILNVGAPCAGMNAAV
RAAVRIGLIQGHNMLAIHDGFEGLAEEKIEPITWNTVGDWTGKGGSELGTKRVLPGKYME
EISLNIAKYNIHALVIIGGFEAFSGALEMVQGRGKYEELCVPMVIIPATVSNNVPGSDFS
IGADTALNTITTTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGFSAGADAAYIYEEK
FGIRDLERNVEHLVEKMKTTVKRGLILRNENCNSNYTTDFIFNLYSEEGKGVFDCRKNVL
GHMQQGGTPTPFDRNFATKMGAKAVLWLTEKLKECYRHGRIFANTPDSACVLGMRKRGLV
LQPLAELKEQTDFEHRIPKNQWWLKLRPIMKILAKYKISLDTSEHALMEHVISKKPPVHM
TLTK
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atggctaacataaatacagctggggtcgatccgacaaagatgggggtcggacgggccatt
gctgtactgacgtcaggtggtgatgcccaagggatgaatgcggctgtgagggccactgtc
agagttggcctttacactggagccaaagtcttctttgtccatgagggctatcagggattg
gttgatggagggaatcacatccgtccagctacatgggagagtgtgtccatgatgctacag
ctgggtggtacagtcattggcagtgcccgctgtaaggatttccagaccagagaggggcgt
ttgaaggctgcctacaatctcgtcaaactaggcgtcactaacctttgtgtaattggtggc
gatggcagtttgactggtgccaacatatttcgcactgagtggagtgacttgctgaaagat
ctgatcagcaaaggtaagatcaaaaatgaggaggccaaagcttcatctcatctgaatatc
gttggtatggttggttctatcgataatgacttctgcggaacggacatgaccatcggcaca
gactctgccctacatcgtatcattgaggtggtggacagtatcaccacaacagcacaaagt
caccaacgtgctttcatcctagaggtcatgggaagacactgtggttaccttgctctggtt
actgctcttgcatgtggtgctgactgggtgtttattcctgagatgcccccagatgacggg
tgggaggatcatttgtgcagaagactcaccgagaccagaaatgcgggttctcgtctgaat
gtgataattgtggctgagggagcaatcaacaaagatgggaaaccaatcacctgtgaccag
ctaaaagatctggtgacaaagagtctgggctttgatactcgtgccactatcctcggacat
gtgcagagaggtggcaccccctccgcttttgacagagtgctaggcagtaggatgggtgtg
gaggctgtaatggctctgctggaagccactccagaaactcctgcctgtgtggtcagtctc
tctgggaaccaggctgtcagactccctctgatggagtgtgtgcaagtgaccaaggatgtc
actgttgcgatgaatgaaggtcgatttgacgatgctataaagctcaggggaaggagtttt
gagaataactggaacacatataagctcctggctcatgtgcgccccccagagacaaagagt
aacattaatgtggctattttgaacgtgggtgctccctgcgctggcatgaacgcagctgta
cgtgcagctgtcaggatcggcctcatccagggtcacaacatgctggccattcatgatggc
tttgaaggtctggctgaggaaaagattgagcccatcacctggaacactgttggagactgg
acagggaaaggtggctctgagttgggaaccaaaagagtgttacctggaaagtacatggag
gagatcagcttgaatattgccaagtacaatattcacgctttggtcatcattgggggtttt
gaggcattttcaggtgcattggaaatggttcaaggcagagggaagtatgaagagctgtgt
gttcccatggtgatcattcctgctactgtatctaacaatgtgcccggctcagacttcagc
atcggagccgacaccgcccttaacaccatcaccacgacctgtgacaggatcaagcagtcg
gcagcaggaactaagcggcgtgtgttcatcattgagactatgggaggatactgcggctac
ctggccacaatggctggtttctctgcaggagctgatgctgcttatatatatgaagagaaa
tttggcattcgtgacttggagagaaatgtggaacatcttgttgagaagatgaagaccact
gttaagagaggcttaattctcagaaatgaaaactgcaattccaactacactaccgatttc
atcttcaacctgtattcagaggagggaaagggggtttttgactgccgtaagaatgtcctt
ggccatatgcagcagggtggcaccccaactccttttgacagaaattttgctaccaagatg
ggtgctaaggctgttctctggctgactgagaagctgaaggagtgttatagacatgggcga
atctttgccaacaccccagactctgcgtgtgtgttgggcatgaggaagagaggactggtg
ttacagcctctggctgaattgaaagaacaaaccgattttgaacaccgtattccgaagaac
cagtggtggttgaagctgaggcctattatgaagattttggccaagtacaagattagtctg
gacacctctgaacacgctcttatggagcatgtcatcagcaagaagcctccagtgcacatg
actctcacaaagtaa

DBGET integrated database retrieval system