KEGG   Sinocyclocheilus grahami: 107563643Help
Entry
107563643         CDS       T04918                                 

Definition
(RefSeq) histone-lysine N-methyltransferase 2D-like
  KO
K09187  [histone H3]-lysine4 N-trimethyltransferase MLL2 [EC:2.1.1.354]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh00310  Lysine degradation
sgh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107563643
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sgh03000]
    107563643
   03036 Chromosome and associated proteins [BR:sgh03036]
    107563643
Enzymes [BR:sgh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     107563643
Transcription factors [BR:sgh03000]
 Eukaryotic type
  Zinc finger
   Cys4 Trithorax
    107563643
Chromosome and associated proteins [BR:sgh03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107563643
   HMT complexes
    MLL-HCF complex
     107563643
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FYRC PHD FYRN SET zf-HC5HC2H_2 HMG_box PHD_2
Motif
Other DBs
NCBI-GeneID: 107563643
NCBI-ProteinID: XP_016104049
LinkDB All DBs
Position
Unknown
AA seq 4349 aa AA seqDB search
MDEQKSNCEENDSETAADDGTSAKENIQFEGELSAPVAAEDISGTTVDTSSSSLETVGAC
ALCNCVERSLHGQRELRCFAPSSDRPRLEPSVSSLPAAGNDDLSSIGFSESTCLASLFDD
TVAAKKNITIKWLQKLPQTLEEWLRTQTMTADTGLSKEDDEEEDDTMQNTVVLFSNTDKF
VLQQDMCVVCGSFGQGVEGQLLACAQCAQCYHPYCVNSKITKMMLRKGWRCLECIVCEVC
GKASDPARLLLCDDCDVSYHTYCLDPPLLTVPKGGWKCKWCVCCMQCGASSPGFQCEWQN
NYNHCGPCASLVTCPVCRENFMEEELLLQCQHCDRWVHAVCESLYTEDEVEQASDEGFAC
TACTPYVPRPVVESPMMSAFKMKEPEPQFYRLEGVWLTETGMSLLRSMSMSPLHKRRQRR
SRLGTMCIDELKEGDADGDEGKGGAEAMECEPKLEAPGSPDREGGVDRETGANGGVEGMA
DCETLKGGVEETEDGKKRKRKPYRPGIGGFMVRQRKCHTRMRRSLSASGDGVPEGQAAEM
KLEEGPHPDIPLDVPEAKTAEGEGEQAKKRRGRKKSKLEDMFPAYLQEAFFGKTLLDQSK
RAFLAPPTQRHTQGILKPPLTGHGARNTASEPVEATARLTGLPVELKQEGEGSKPPGDRA
AEGQGASGQLSNKDQSSGDTHGSDIQKNEDLPQGLEGQDSQQFFQKVLGPTEGSAASGPL
QPSIKTVQEGDSNQSSCLQRNLLGASLSGALPSTGMMDSFSGLSQSPFFDIRDRGGLFSP
DQDEESPWATPSTPATPSTPPTPTEQEGDGLSYNQRSLQRWEKDEELGNLSTISPVLYAN
MNFPSLKQDYPDWPSRCKQIMKIWRKVSAADKVPYLQKAKDNRAAQRINKAQKQAESQVC
RPIKTEPGRIKGERPNLHLQIPPPSGSVSTPSQPSSAESPYPLAPDSASSAFFSDGPLKT
PCSADAQTDPFSKLASQSPHLQSQPSTPYSQPSSSPLSASSSGYPIPGSQGATQGRPASF
GSLDMQPGNPRRAQQVDPFFKPQQQIPKPQQPSQEALGPPESPRPRTGGPGDSQMFSPPH
TTHCGDPYRGQHGASRQDHVSSPSPSAIASSPAGVGPNRVEINAPSPRSSFGRQDLSSGS
PASLDSGDGLFKAPMTPRMHQGDAGGLSVSHPSGASPNHPPESYRQSPSTFSDPYSQPPL
TPRPQSGDGSSPLPQRLPVPQQETYSRLPSSPQSPLTQGTISNDVLSVQSPATPRFQSPD
PYSRPPSRPQSRDSFASLHKPPRPSSVAPEGNSPFRGSPHSSQQPPCSPSVADPLSGKPP
FSCSPSVGLQMGQQQVVGQQQMMTPQQAQVHLPQSQTQAVGAEFNLRIALPPGNQDTAVR
ATDAPHLPNLPGVQDMSDLSAGQDPALMNLSPSELEKHRQRQRLREFLIRQKMQRNSLRQ
EKDAPLVGNPAPSWPGGEMPAFQQNKSQRAPPPYPQDRAVVAQAALATRMPPPVGAMDEK
LCRPPPSGTPATMDPSALRQAGPNISQGMYSRPPYPAQWQNQGSPRRFPQPSMMEAVPRQ
HLNTPINNPLNIQSMPNMPNPLTGVPGTGTEAVQSHVSGAPPQFIELRHNSQRMPLSSQF
MQRVPIPRPRMFLPQQEMNAAFVQQNLPPSLDASVEGMRDPRIGLQPGGMNQLMQQQSNV
PPSQSQLQPQQVPTTTPKTPISHTTTQQLPQTSTIRGQQTVVNPVDLPESDLGLGDTVAE
TGVEDDDLATLDLDPDKGDDDLGNLDNLETNDPHLDDLLNSDEFDLLAYTDPELDQGDPK
DVFSDQLRLVEAEGEGPGSSANVEIKVEEKPKVDIAAKDTHTTATQPPLKTESSSTSTPK
VESSDAIRLSSVKLEDKGLIEQPQSGQAPVKDDISATVSVLLSGTKASNQPESATASLNT
VRLGGIPYPLPSQSFPPTAPHPDLGDDPLGLPDAGHHSTADDLDKVESSLEASELPLLIQ
DLLEHEKKELQKQQQQQQQLGALQGGIASQLHSIQNQQQPPQGPNQIMMPQHHHPSQGIV
PQAGMVPRPPHMSPQQQQRLIGAAVPSPPHAAMGQPQGVLRGVQPGRIHPGLTPQQQTAT
PTHIVKQQNLASNFLPDKDLEKFGTDDIMDPIAKAKMVALKGIKRVLAQDPMGVPPGMNR
QQVSLLAQRLTSAPGNEDSQAQLAPGSSKEGEGSNQVQTRPNPPQFGIINDAEQHQYEEW
LVHTQQLLQMQLKFLEEQIGAHRKSRKALCAKQRTAKKAGREFAETDAEKLKLVTEEQSK
IQKQLDQVRKQQKEHTNLIAEYRSKQQQHQQGSSILAPGPSTQAPHMLSKMPGQMIMGQQ
GGPIIGQPPGGMPQVGVPQGGMPVRMPQMQTFGGAQPSLPLGVGTVQPVPPPGFFQQAPG
AQGPDPRVIQERQLQQRMQMVQKMQQQQQQQLMMGQQPMSHQPQQPGIVNQQPGAMGNQP
TQVLVGNMGQQQTNLQQGLMNNQQNQQGLMQTTPGMMGNQTIGQTQHNVLGQPMTQTVNM
MVGHPQGMVGNQQIVQQLQRPQGLMDQHGPGGQHVVRGPPTQLPSQQQSVMAQRILMSQQ
QQNAAKNLAQLQQQQISQLKQPTQVGPSEPQRALETPPSGSTQGVAENLQQGVQDLQNPD
RKDGGLLNPKTPSQQGGPPTPLQMQQHGSSGEQKCGVGQPQQPHAFLGQQQTAQPQSNQN
IGVAEQHGFVGNQQAGSHLKVQPQQQQIQLGLQTQNTIQIKQEDQQMCFMAQQQAGQIAA
QQPQDMLGQNSGQTQSTMAGISNQHQQALLTQQMGIPRGQQMMMTPRPGAPAGQIRAPIN
IQAFIAQNPQLRHLTPSQQLQQIQAIIAQRQLQQGQMLRMQGLAQGQMRPQVPQGPPVGT
RMPGLEIQQQQHRFALTGKHGPAGTQQQSGAMGQLPGMAPQFHQGVSGAMQQPSQGPLPQ
YINSAQQQQMLQQQQVHQHQMMRGQVPRPVMGQVRATAPGHMARPMSPRQLVGQGSPGSP
LPNQQRLMRMSQTPPGPQHLQQQQSHVATALSPFQASPSHVGSPAGYSVPEPGSSPASAH
KPEPGTLSFSSHLSSPSRPDSVVGKSSPFSQTGGSIASPMRSPAAKTQSPNTETLSAPFP
LNGPSPQLAQNPHQATTAAQVSDSHMSQPTQLLSEMTLQNIKQEPREVQCDTGGSVEAHS
DGIKREISGETVSATAFANCAILGSRNQAGVLGSQIQRTETGQQLLQKLLRTKNLQMASQ
RPSDGIHNEINGHINSKLAMLEQKLQGTPRNMEDLQSLTKRTPIVKAKRTTKAGERGPNS
RKKTKKEEVGKTEAIMKQLKQGLSLLPLMEPSITASLDLFAPFGSSPANAKAQLKGSFGN
AMLDNIPDYYSQLLTKNNLSNPPTPPSSLPPTPPPSVQHKLLNGVTLAEGQKETEASEDT
MGSVPEEVKSVDILAALPTPPHNQNEDIRMESDDDSDAPDSVVPASSPESQLGDETTRFP
HLLDPKEEEDERAISPVIPIIPRSAIPSFPETKPFESVDGKVVASSSQWDKTKSNEVSVT
FMLSSAAAKNINTVMLTVAQLLHIRMPSSYEAAFPQSPGRAGVGPGKVPDTSNPGMKADT
SASHDAEWLKQFDVSLPGCTLRKQVDILALIKQECQEQEDRPAQHCYMTNVSDLDVRHLP
VIPVEVSPPPSPSPPPPPSSAVAEPENITQPEPKPEPDAPVQTTSSPSASPSAPAKTESI
VKLESHSSPVTVESESQEPVVLPQAAPSEEQQPPAPASSPLLDSPTMEISLKPIKHRSRP
LSDEEEERPKVKKWKGLRWKRLQIVITIRKGGSKKENSREVSELMERLRITLKPDKLPRD
KRKCCFCHEEGDGATDGPARLLNIDVDLWVHLNCALWSTEVYETQGGALINVEVALRRGL
RTRCAYCQKTGATNSCNRLRCPNVYHFACAIRARCMFFKDKTMLCTQHKLKCPSEEELSS
FAVFRRVYIERDEVKQIASILQRGDRIHMFRVGGLIFHAVGQLLPCQMVVFHSPTAIFPV
GYEATRIYWSTRVPNRRCRYRCRISEQDGRPLFEVRVLEHGYEDLHFRDTTPDGIWSKVV
QQVAKLRDEAAMLKLFTEHVKGEEMYGLTVHAVMRITESLPGVENCQNYTFRYGRHPLME
LPLMINPTGCARSEPRVLTHCKRPHTLNSTSMSKAYQSTFTGEINTPYSKQFVHSKSSQY
RRLKTEWKNNVYLARSRIQGLGLYAAKDLEKHTMVIEYIGTIIRNEVANRREKIYEEQNR
GIYMFRINNEHVIDATLTGGPARYVNHSCAPNCVAEVVTFDKEDKIIIISSRRIPKGEEL
TYDYQFDFEDDQHKIPCHCGAWNCRKWMN
NT seq 13050 nt NT seq  +upstreamnt  +downstreamnt
atggacgagcagaaatcaaactgcgaagaaaatgattcagaaactgcagctgatgatggg
acctctgcaaaggagaacatccaatttgagggggaactgagtgcccctgttgctgcagag
gacatctcaggcactactgtggacacttccagctcatcattagagactgtcggggcttgt
gctctgtgtaactgtgtggagcgtagtctgcatggacagcgggagctccggtgttttgca
ccctcttccgatcggcccagattggagccctctgtgtcctctttgccagcagctggaaat
gatgacctgtcttccattggattctctgaatccacctgtctggcatctctctttgatgac
acggttgctgcaaagaagaacatcacaattaaatggcttcagaaattgccacagacactt
gaagaatggttacggacacaaaccatgactgcggacactggacttagcaaagaagatgat
gaggaggaagatgacaccatgcaaaatactgtggtacttttctccaacactgataagttt
gtcctgcagcaggacatgtgtgtagtgtgtggtagttttggacagggtgtggagggccag
cttctagcctgtgctcagtgtgcacaatgttatcatccatactgtgtgaacagcaagatc
accaagatgatgttgagaaaaggctggcgttgtcttgagtgcatcgtgtgcgaggtgtgt
gggaaggcttcagaccctgcccgtttgctgctttgtgacgactgtgatgtcagctatcac
acttattgcttggacccacccttactgactgtgcccaagggaggctggaagtgcaaatgg
tgtgtgtgctgtatgcagtgtggtgctagctcccctgggttccaatgtgagtggcaaaat
aactacaatcactgcggcccttgtgccagcctggtaacctgtcctgtgtgtcgtgagaac
ttcatggaagaggagctgcttctgcagtgccagcactgtgacagatgggttcatgctgta
tgtgagagtctttacactgaggatgaggttgaacaagcatctgatgagggctttgcctgt
acagcctgcactccatatgtccccaggccggttgtggagtctcctatgatgtcagccttc
aaaatgaaagaaccggagccacaattttatcgtctggagggagtctggctaacagagact
ggcatgtctttattgcgaagcatgtccatgtcacccctgcacaagcgcagacagcgccgg
tcccgactgggcaccatgtgtattgatgagttgaaagaaggcgatgcagatggtgatgag
gggaaaggaggtgcagaagcgatggaatgtgagcccaagctagaagcccctgggagccca
gatagggaaggaggagtggacagagaaactggggcaaatggaggtgtagagggcatggct
gactgtgaaactctcaaaggaggagtagaggagactgaagacgggaagaagagaaagcgt
aaaccatacagaccagggattggagggttcatggtccggcaaagaaagtgtcacacacga
atgaggaggagtctgtctgcctctggtgatggtgttcctgaaggtcaagcagctgaaatg
aaacttgaggaaggacctcatcctgacatacctctcgatgtcccagaggcaaaaacagca
gagggagagggtgagcaagccaagaagcgcaggggcagaaagaaaagcaagttggaggac
atgtttcctgcatacctacaggaggctttctttggcaagacattactcgatcaaagtaag
agagcttttcttgctcctccaacccaaagacatacgcagggcattctaaaacctccactc
actgggcatggtgccagaaatacagcttctgaaccagttgaggccacagccaggctgact
ggtcttcctgtggaactaaagcaagagggtgagggatccaagcctccaggagatcgagca
gcagaagggcaaggagcaagtgggcaactttccaacaaagatcagagctcaggagataca
catgggtctgatatacagaagaatgaagatctccctcagggactagaaggtcaagactct
cagcagtttttccagaaagtacttggacccactgagggaagcgccgcaagtgggcctctg
cagcctagcattaagactgttcaagagggtgattcaaatcaaagtagttgccttcaaaga
aaccttcttggtgcttccttatctggcgcactcccctcaactggtatgatggactctttt
tctggtctctcccagtctcccttttttgacatacgtgatcgaggtggtcttttcagtcca
gaccaggatgaggaaagcccatgggcaacaccatccactccagccaccccttccactcct
ccaactcctactgaacaggaaggtgatggcctctcctacaatcagcgcagtctgcagcgt
tgggagaaggatgaggaattgggaaatctatctaccatctctcctgtactatatgctaac
atgaacttcccaagtctcaaacaggactaccctgactggcccagtcgctgtaaacaaata
atgaagatttggaggaaggtatcagctgcagacaaggttccttatctgcaaaaggccaaa
gataatagggctgctcagagaataaacaaggcacagaagcaggctgaaagtcaagtatgt
cgccctatcaaaactgagcctggccgtattaaaggcgagcgccctaatctgcacctccaa
attcccccaccatcaggctccgtatccactccttcccagccaagctctgctgagagtcct
taccctcttgctcctgactctgcatcttcagcctttttttctgatggacccctcaagact
ccttgctcagctgatgcgcagacagacccattttctaaacttgcctctcagtctccacac
cttcagtctcagccatccaccccatactcacagccttcttccagccccttgtcggcctct
tcctcaggatatcctatacctggctcacagggtgctactcagggacggccagccagcttt
ggctcccttgacatgcaaccagggaatcctcgcagggcccagcaggttgacccatttttt
aaaccacaacagcagatccccaaacctcagcagccctctcaggaggccttaggtccacct
gagagtcctcgacctaggactggtgggcctggagactcgcagatgttctcaccgcctcat
acaacccattgtggtgacccttaccgtggccagcatggagctagccgacaagatcatgtt
tcgtctccatcaccatctgcaatagcttcttcacctgctggggtgggcccaaatagggta
gaaattaatgccccatctccacgctcttcttttggccggcaagacctaagctctggttct
cctgctagtttggactctggagatgggttattcaaagcccccatgacccctcgtatgcat
cagggggatgcaggtggattgtctgtttcacacccttcaggtgcctctcctaatcatcct
cctgagagctaccgtcaatctccctctacgttctctgacccttactcccagcctcctctc
acaccgcgacctcaatcaggtgacggatcctctcctctaccccagagacttcctgtgcct
cagcaagaaacatattcaagattaccttccagccctcaatcgcctctcacacaaggaacc
atttccaatgatgtgctttctgtgcagtcaccagccactccacgcttccagtcacctgac
ccttactctcgtccaccttcacgacctcagtccagagattccttcgcttcattgcataaa
cccccccgcccatcttctgtagcaccagaaggtaactccccctttagaggttcacctcat
tctagccagcaacccccctgctcaccttcagtagccgatccgctctctggcaaaccccca
ttcagctgcagtcctagtgtagggcttcaaatgggccagcaacaagtagttggccagcag
cagatgatgactcctcagcaagctcaggtccacctcccacagtcccagacacaagcagtg
ggtgctgaatttaacttgagaatagcacttccacctggaaaccaagatacagctgtgagg
gcaacagatgctccacatttacccaacttgccaggggtgcaggatatgtcagacctgtcg
gctggacaggatccagctctcatgaaccttagtccatcagagttagaaaagcacagacag
aggcaacgattgagagagtttttgataaggcaaaaaatgcagagaaactcacttcgccaa
gagaaggatgcacccttggtgggtaatcctgctccgagttggccaggcggggaaatgccg
gcctttcagcaaaacaaaagccagcgagcaccacctccttaccctcaggacagagctgtg
gttgctcaggcagcccttgccaccaggatgcctccgccagtgggagcaatggatgaaaag
ctttgccgcccacctccttctgggacaccagcaactatggaccccagtgcattaaggcaa
gctgggcccaatatttctcaggggatgtattctcgtccaccatatcctgcacagtggcaa
aaccaaggttctccgcggaggttcccacaaccatctatgatggaagctgttcccaggcag
caccttaatactcctatcaacaatcctctcaacattcagtccatgccgaatatgcccaat
cctttgacaggggttccaggcactggcacagaggctgtacaaagccatgtgtcgggagct
ccacctcagtttatagagctgaggcataattcacagaggatgccgctgagctctcagttt
atgcaaagggtgcctatacctagacctcgcatgtttcttccacagcaggaaatgaatgct
gcttttgttcagcagaatttacccccatctctggatgcttcagtggagggaatgcgtgat
cccagaattgggttacagccgggtggcatgaaccaactgatgcaacaacaaagcaatgta
cccccttctcagtctcaactacagccccagcaggtgccaactactacacccaaaactccc
atttctcacactactactcaacagcttcctcaaacaagtacaataagaggtcagcagact
gttgtgaatccagttgacctacctgagtctgacctagggctaggtgatacagtggcagaa
accggagtggaggatgatgatcttgctactcttgacctggatccagataaaggtgatgat
gatttgggaaaccttgacaatcttgagaccaatgatcctcatttggatgatctgctcaac
agtgatgaatttgatttgctggcttacactgaccctgagcttgatcagggtgatcccaaa
gatgttttctctgaccagttgcgacttgtagaagcagagggagaaggaccagggtcttct
gctaatgtagaaatcaaggtggaagagaaaccaaaagtggatatagctgccaaggatacg
cacacaactgccactcaaccacctttaaagactgagagttcatctaccagtactccaaag
gtagagtcttctgatgccattaggctatcctctgtaaaacttgaagacaagggattgatt
gaacaaccacagtcaggacaagctccagttaaagatgacataagtgcaactgtgtctgtt
ttgctcagtggaacaaaagcctctaatcaaccagagtctgcaactgcttcattgaacacc
gtccgtttaggtggtataccttatcctcttcccagccagtcttttccaccaactgcacca
catccggacctgggtgatgatccacttggattgccagatgctggccaccactctacagca
gatgatcttgacaaagttgaaagctcactggaagcgagtgaactacctttgttaatacaa
gaccttttggagcatgaaaagaaggagctacagaaacaacaacaacagcagcagcagtta
ggtgctctacaaggagggattgctagtcaacttcacagcattcagaatcagcaacagcct
cctcaagggccaaatcaaattatgatgccacagcaccaccatccatcccaaggcatagtg
cctcaagcaggtatggtgcccaggccacctcacatgtcaccacaacagcagcagaggtta
attggtgctgcagtgccttcacctccccatgcagcaatgggacaaccgcaaggcgtttta
cggggtgtgcagcctggtagaattcatcctggtcttactccacagcagcagacagcaaca
cctacacatattgtcaaacagcagaacttggccagcaactttttaccagataaagatctg
gaaaaattcgggacagatgacataatggatcctattgcaaaggctaaaatggttgcgctg
aaaggaattaaaagagtgttggctcaagatcctatgggtgtaccaccaggaatgaatagg
caacaagtatctcttttggctcagaggctaacctcagcccctggaaatgaggattcccag
gctcagcttgcacctgggtcttccaaggaaggagaaggcagcaaccaggttcaaacaaga
ccaaatcctccgcaatttggcatcatcaatgatgccgagcagcaccaatatgaagaatgg
cttgtgcacacccagcagttgctgcaaatgcagttgaagttcttagaagagcaaattgga
gcacatcgtaaatcccgtaaagctctgtgtgccaagcagcgtactgcaaagaaagctgga
cgtgaatttgcagaaacagatgctgaaaagctcaaactcgtcactgaggaacaaagtaag
atccagaaacagttggaccaggtgcgtaaacagcaaaaggagcacaccaatcttattgca
gagtaccgaagcaagcaacagcagcatcagcaagggtcttccatactagctcctgggccc
tctacacaggccccccacatgctttccaaaatgcctggacaaatgattatgggccaacaa
ggaggtccaattattggtcaaccacctggaggaatgcctcaagtaggggtgcctcaggga
gggatgccagttagaatgccacaaatgcaaacttttggtggagcccagccttctcttcca
ctcggagttggcactgtgcaaccagtcccacctcctggttttttccaacaagcccctgga
gcacaaggaccagatccaagagtcatacaggagcgacagttacagcaaagaatgcagatg
gtccaaaaaatgcagcagcagcaacaacaacagttgatgatggggcagcagcctatgtcg
catcaacctcagcagcctggcatagttaatcaacagcctggagccatgggcaaccagcca
acccaagttttggtcggcaatatgggccagcagcaaacaaacttacaacaaggattaatg
aataaccagcaaaatcagcaggggttaatgcaaacgactccaggtatgatgggaaaccag
actattgggcagacgcaacataatgtcttgggccagccaatgactcaaactgtaaatatg
atggtaggacatccacagggtatggttggtaatcaacaaattgttcagcagcttcagaga
cctcagggtttgatggatcaacatgggccgggtggacagcatgttgttagggggccacca
acccaactcccgtctcaacagcagagtgtaatggctcagcgcatactcatgtcacaacag
caacagaatgctgcaaaaaaccttgctcaacttcagcagcaacaaatttcacaactgaaa
caaccaacgcaggttgggccctctgagccacaaagagctttagaaactccaccatcaggg
agtacccaaggggttgctgagaatttacagcaaggtgtccaagatcttcaaaatcctgac
cgtaaagatggaggactacttaatccaaaaacaccctcccagcagggtggacctcctaca
ccacttcagatgcaacaacatggatctagtggagagcagaaatgtggtgttggacagcca
cagcaaccacatgcttttctgggtcaacaacagacagcacagcctcaatcaaaccaaaat
atcggagtagcagaacaacatggttttgtgggcaaccaacaggctggatctcatcttaaa
gtacaaccacagcaacaacagattcaacttggtcttcagacccagaacaccatacaaata
aaacaggaagatcagcaaatgtgctttatggcacaacagcaagctggtcagattgctgca
caacaaccacaggatatgcttggccaaaatagtggtcagactcaaagtacaatggccggc
atttcaaatcaacatcagcaagctctcttgactcaacagatgggcattcctagaggccag
cagatgatgatgactccaaggcctggtgctccggctgggcaaatacgtgcccctattaac
attcaggccttcattgctcagaacccccaactgcgtcacctgactcctagccaacagttg
cagcaaattcaggcaataattgctcagcgacagctacaacaaggccagatgctaagaatg
caaggtctggctcagggacaaatgcgtccccaggtcccacaggggcctccagttggtaca
cggatgccaggtcttgaaatccaacaacagcagcaccgctttgccttaacaggcaaacac
ggtccagctggcactcaacagcaatcaggagcaatgggacaattacctggtatggctcca
cagtttcatcaaggtgtttcaggggctatgcaacagccttctcaaggacctttgcctcag
tacatcaatagtgcccagcagcagcagatgctacaacagcaacaagtacatcagcatcag
atgatgaggggtcaagtacccaggccagtaatgggtcaagttcgtgcaacggcacctgga
catatggctagaccaatgtctcctcgtcagttagtgggtcagggttctcctggaagcccg
cttcctaatcagcaaaggctcatgagaatgtctcagactccaccaggcccccagcacctt
cagcaacaacaatcccatgtggcaacggcactgagcccctttcaagcctctccctctcat
gtgggttctcctgcagggtattctgttccagaacctggttcaagcccagcatctgcacat
aaacctgagccaggcaccctgtctttctccagtcacttgtcatcaccttctaggccagat
agtgttgtaggaaagagtagcccctttagccagacagggggatcaattgcttcacctatg
agatctccagctgccaagactcagagccccaacactgaaactctttcagctccttttcca
ctcaatggtccgtctcctcagttggcacagaacccacaccaagcaacaactgctgcccaa
gtatctgacagtcatatgtctcaaccaactcaactgctcagtgaaatgacactgcaaaac
atcaaacaggaaccacgtgaagtccagtgtgacacaggaggtagtgtagaggcccattct
gatggcataaagagagaaatttctggagagacagtcagtgccactgcttttgcgaactgt
gctattctgggctctagaaatcaagcaggagttctcggatcccaaattcaaaggacagag
actggccaacagcttctgcagaaactccttcgaaccaaaaacttacaaatggcttctcag
aggccatcagatggcattcataatgagataaatgggcacatcaatagcaaactggcaatg
ctggagcagaagcttcaaggaacgccacgaaacatggaggatctgcaatccctcacaaag
agaactccgatagtcaaggccaaacgtaccacaaaagctggagagcgtgggccaaactct
agaaagaaaaccaagaaagaagaggttggaaaaactgaggcaataatgaagcagctgaaa
caaggactttcacttcttcctttgatggagccttccattacagctagtctggatttgttt
gctccttttggaagcagcccagccaatgccaaggcccagttaaaaggctcatttggaaat
gctatgctggacaatattccagactactattcccaacttcttacaaagaacaacctcagc
aatcctccaacaccaccatcatcacttcctccaactccaccaccttctgtgcagcataag
cttctaaatggagtgacactagcagaaggtcagaaagagacagaggcatcagaggatacc
atgggttctgttccagaggaagtaaagagtgtagacatactagcagctctccctactcca
cctcacaaccaaaatgaagatatacggatggagagcgatgatgacagtgatgctccagac
agcgttgtgcccgcatcctcacctgaaagccaactaggtgatgagacgacacgctttccc
catctgttggatcccaaagaggaggaagatgagagggccatctctcctgttatccccatt
attcctcgttctgccattccaagtttccccgagacaaaaccatttgagtcagtggatggg
aaagttgtggcctcatccagccagtgggacaaaaccaaaagcaatgaagtgtctgtaact
ttcatgctttcttcagctgcggcaaagaatatcaacacagtgatgttgactgttgcccaa
ctgctgcacatacgtatgccaagttcctacgaggcagcttttccccagagtcctggtaga
gcaggtgttggacctgggaaagtacctgacacttccaacccaggtatgaaggcagacact
tctgcaagccatgatgcagaatggcttaagcaatttgatgtttccctcccagggtgtacc
ctgaggaaacaagttgatattctcgctctcatcaagcaggaatgccaagagcaagaagat
agacctgctcagcactgttacatgacgaacgtttcagatctggatgtgcgccacctgcct
gtcattcctgtcgaggtttctcctcctccatcaccatcaccacctccacccccatcatct
gctgtagctgagccagaaaatatcactcaacctgagcccaaacctgaaccagatgcacca
gttcagactacatcatccccttccgcaagcccaagtgctcctgccaaaactgaatctatt
gttaaactggagtctcacagctccccagttacagtggagtctgaatctcaggagcctgtg
gtccttccccaagctgctccatcagaagaacaacagcctcctgctccagccagttctcct
cttctagactcccccacaatggagatatccctcaagcccatcaagcaccgtagcaggcct
ctttctgatgaagaagaagaacgacccaaggttaaaaaatggaagggtcttcgctggaag
cgtctccagatagttatcactattcgcaagggagggtctaagaaagagaacagccgtgaa
gtttccgagctcatggagcgcctccgcattacgctgaaaccagacaagctaccccgagac
aagcgcaagtgctgcttctgccatgaagagggagatggtgccacagatggtccagcacgc
ttgcttaacatcgatgttgatctgtgggtgcatcttaactgtgctctatggtccactgag
gtgtacgagacccagggcggtgcacttattaacgtggaggttgcccttcggcgtggacta
cgcacccgctgtgcctactgtcagaagacgggtgctactaacagctgcaatcgtttgcgc
tgcccgaatgtttatcattttgcctgtgccatacgggcacgctgcatgtttttcaaagat
aaaactatgctgtgcacccagcacaagcttaaatgccccagtgaagaggagcttagcagt
tttgctgtttttcgacgcgtctacatcgaacgagatgaggtgaagcagattgcaagcatc
ctacaacgtggtgaccgtattcacatgttccgtgttggcgggctcatcttccatgccgtg
ggccagctcttgccctgtcagatggttgtgtttcactcaccaactgctatctttccagtg
ggctacgaggccacacgcatttactggagcactcgggtgccaaaccgcagatgtcgctac
cgatgtcgtatcagtgagcaggacggcaggcccctgtttgaagtgcgtgtgctggagcac
gggtatgaagacctgcacttccgagacaccactccagatggaatttggtccaaggttgtg
cagcaggttgccaagctgcgtgatgaagcggccatgttgaaactcttcaccgagcatgtc
aaaggagaagagatgtatggtctcactgtccacgcagtgatgcgaatcactgaatcgctt
cctggtgtggaaaactgtcagaattatacgttccgatatggccgccatcctctcatggag
cttccactcatgatcaatcctacaggctgtgcacgatcagaacccagagtgctcacccac
tgcaaacggcctcatactctgaacagcacgagtatgtccaaagcctatcagagcacattt
acaggagagatcaacaccccgtacagcaagcagtttgttcattccaaatcttctcagtat
cgtcggttgaagaccgagtggaagaacaatgtgtacctggcccgttctcgcattcaagga
ctgggtctgtacgctgctaaagaccttgaaaaacacaccatggtcattgagtacattggc
accatcattcgcaacgaggttgcaaatcgcagagagaagatttacgaggagcagaaccgt
gggatctacatgttccgtattaataacgaacatgtgattgatgccaccttaactggcggt
cctgcccgttatgtcaatcattcgtgtgcacccaactgtgtcgcggaagttgtgacgttt
gacaaagaggacaagatcatcataatttctagtcgcaggatcccgaagggtgaagagctg
acgtatgactatcagtttgacttcgaggacgatcagcacaagatcccctgccattgtgga
gcctggaattgcagaaagtggatgaactaa

DBGET integrated database retrieval system