KEGG   Sinocyclocheilus grahami: 107563992Help
Entry
107563992         CDS       T04918                                 

Definition
(RefSeq) serine-rich adhesin for platelets-like isoform X1
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107563992
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sgh03036]
    107563992
Enzymes [BR:sgh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     107563992
Chromosome and associated proteins [BR:sgh03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107563992
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 107563992
NCBI-ProteinID: XP_016104460
LinkDB All DBs
Position
Unknown
AA seq 2123 aa AA seqDB search
MEGSYRMSVRELCETDDLATSLVLDPLLGFSTHKMNISPPPEIRRWGYLRGTLLRFKRTH
DFQATFDALLDGEWVSGYFTGLGSHRQELLKQHMYRYMTAFLLDSGVNIEPCNRYSSETN
GAKITSTRHWLVGERVEVLQGCIAELSPEDSAVLRAGVNDFSVMYSMRKRCAQLWLGPAA
FINHDCRPNCKFVPGDKNGACVKVVRPISPGEEITCYYGDSFFGENNEMCECCTCERRGE
GSFKKRDQSPDVACSMDPSGQKYEFRETDLRLNRNRGNGTPKPFLTVSNSALPMRNTFSQ
RTKRNALVLSKMRKTDRWRREEQCKQVEKKTQNLLSSLPHLELKELSICLYQHSTNFLLS
CKDPLSKERALLYLIEKERPKPERITRNSKSVSPPLSSANINGPEERKDEDGEMLNEDPV
IRFKPFTLGCVSSVHERDSMKAKGRNIDASSVRIVHQGISSRTRNILRSRLSSLQARSRS
KLPGFNTRRTRLIKSNSKLSTGQNECSDSQTQDGKQQKGSEVESKDNTNPVLITPGKPCT
DKCVHIDGDTGTNSDKSSQTESTVIRETQQRVFRDCLREVAGDGGHISGSIAPREGDVSS
CVASETSGDNKQNHRQSVSSSAVSVTPSLSSPSLNSPVSLLSGLNRYLRVSLVRVAIPGK
PEVERTGQREADSTRDKVTAAASVQQSTKFNGSKESNIQGKKGVKELYFTPVNMESAEKY
LKVTCDLETDKNAVTQPAVKELVDVYGKDSHSEYEIEGKQDDKVVTVTSVEVTIPKNSEN
AVKNRKGADKDKKQKHVESVPKVQDKESSIKKQEEVIVEGNYLKKKVLTASFGSRTVVVK
EARVLLMDIRKSLSCKFSQQDKDANDHQPPCSYSGIGEADNMKTLLLADNKETKDKHDAL
NNKNEHPNQGLTAADQSNIHEDTQEKQSESALNSSEPPSMCMVSLDHSPQSSIPLKKRAF
RESLDTDPEQDVNVPATPCTDGSKGKEPNSEYLLPKPRESSSVDTTLMKCSIPESSLSLK
DNVCIGSKKRGSSKLIKTSAKQYCKGLQSTHRGPGKNSVRVPEYRDSTSKVHVCERTIND
PKSEITEAVKCNMGEKSDKGLGGGNKGPGDCEITDNIEHAIKDEWSTSDDLDKTEEEQRL
NVRIRLKRKRGKEWAMECTDEAKSVVDKSSPQQCLALVDPFSAILDTVSILNAEMERIRG
HGEADNGVGLEKATKAVQDVLEHCRKECAAKPCKRQQKVSAVHINKNVSTPNEIVEDSSD
VTDKQVQQKSSSPKIEVDIDDIKPLPLIRLCRRAEGKWEVEWKEAQNEDGSTDTLHREPK
KLTSVFSTAAIVEQMPLGKVKEENPSQCQKLMAGRSCTFRDPLSFETSPLPISLSPLSLY
SPCYDGLAGVGNVSGSIQAKDNVRENVSDSLNSFKTGVIRTDNKGRDDICLSHNLFQINK
SLSKLQALSQSQVCEKSVPTNTSITSSQVQSPSISPFTTECSFSNYSEDVLDFPCLNLES
YDQMPAQNNLASSLIDYCPGEPHNTGSFSSPFSQSPTDAWNPETPYLGSPSPVSNFSSGE
ELCFPDIVFAQSDTSSSIGASQLFFKDKLCNTATSSAPLQDPEKDLYLSDGELSKTPIEL
QVQEDSALQFLPKDLTMFNNASTSAKQPGHSTVRIHPQDKKLHFLDSIINTKSSESYLAK
IDIKDNIHGPLNLHSSKAKSESVFPNLSTHSLHGAGPHSNLVTPFHSLHVGNKSTSLADY
PGAFNSGNALFRSSDKKLPFFPNPKNVSKTEEGQNACRISMAAGSSKSHNNMESIYACPG
PSSSHSGKESSARCPNAEFSRLAENLQKKTKNIPSKQYPTNPGQQGDRIHPVYFISSSKT
TTNVFKNIKPQITRNDKDPCLPSTYLFSSSQGSQCYSTTQSKPSRLEKPHAVVAPTQNTQ
LSGVSSIQPNKDQMCSNISHCDSSAFNFSSSLSPPASQHSSPHLGYRESSVPEVPLFKTQ
STTFEHGQPPHQSYVVNFTGDHSVTLGYSEDGGSLNYTGSGPANYTYHCLMEPSGTQGRL
VVEACGPSNFSPSPSASRFAGSKVHGGQVSRDQQHQGTGTHPCNSLHFSTSHSQSTPITD
RKPKRLRLVVTDGTVDLDLQYTD
NT seq 6372 nt NT seq  +upstreamnt  +downstreamnt
atggagggatcttatagaatgagtgtgagagagctttgtgagacagatgatctggccaca
agtctggtgctggatcccttactggggtttagcacccataagatgaacataagtcctccc
cctgagatccggcgatggggttacctcagagggacacttctacgcttcaaacgcacacat
gacttccaggccacctttgatgccctgttggatggggaatgggtcagtggctatttcacc
gggctgggttcacaccgacaggagttgttaaagcagcatatgtatcgctatatgacagca
tttctgttggacagtggagtgaacattgagccatgtaaccgctattcttctgaaacgaat
ggagccaaaatcacatccacccgacactggcttgtgggagaacgggtggaggtactgcag
ggctgtatagctgagctgagccctgaggatagtgctgtcctcagagcaggagtgaatgac
ttcagcgtcatgtactcgatgcgcaagagatgtgctcagctttggttggggccggctgcc
ttcatcaatcatgactgcagacccaactgcaagtttgtccctggagataagaatggagct
tgtgtaaaagtggtgcggcccatctcgccgggggaggagattacctgttactatggggac
agcttttttggggagaataatgaaatgtgtgaatgttgcacatgtgagaggagaggagag
ggatcatttaagaagagagaccagtcaccagatgtggcttgctccatggatccttcagga
cagaaatatgagttcagagagaccgacctaaggcttaacaggaatagaggaaatggcacc
ccaaagccgtttctcactgtatcaaactcggctttgccaatgaggaatacattttcccaa
cggacaaagaggaacgcccttgttttgagcaagatgagaaagactgataggtggaggagg
gaggagcaatgcaaacaggtggaaaagaaaacacaaaacctcttatcatctttgcctcac
ctcgagctaaaggagctgagcatctgcctctatcagcacagcacaaatttcctattaagc
tgtaaagatcccttgagcaaagaaagggccctgctatacctaattgagaaagagcgacca
aaaccagagaggatcacaaggaacagcaaatctgtctctccaccactcagtagtgctaac
ataaatggaccggaggagagaaaagatgaggatggagaaatgttaaatgaagaccctgtc
attagatttaaaccctttactcttggatgtgtttccagtgtacatgaaagagacagcatg
aaggccaagggacgtaacattgatgcatcatctgtcagaattgtccaccagggcatttcc
tcaaggaccaggaatattcttcgtagtcgtctgagcagtctccaagcaaggagtcgatct
aaactcccaggattcaacacaaggaggaccagactgatcaaatcgaactctaaactctct
acagggcaaaatgaatgctctgactctcagacacaagatgggaagcagcaaaaaggaagt
gaggttgagtccaaggacaatactaaccctgttttaatcactccaggtaaaccatgtact
gataaatgtgtacacattgacggagacactggaactaacagtgacaaatcatcacaaaca
gagagcacggtgatcagagagacgcagcagagagtctttagggattgcctcagggaagtg
gctggtgacgggggacacatcagcggttccattgctcctagggaaggtgatgttagttct
tgtgtagcttcagagacctcaggggataacaagcaaaaccacaggcagtctgtctcttct
agtgctgtaagcgttacaccctccttgtcttcaccatctcttaatagtcctgtctctctc
ctctcagggttaaatcgttacctcagagtcagtctggtacgggtggctatcccaggaaag
ccagaggttgaaagaacaggtcagagggaggcagacagtacaagagacaaggttacagca
gcagcatcagtacagcagagcacaaaatttaatgggagcaaagaaagcaatattcaaggt
aagaaaggggtgaaggagttgtatttcacaccagtaaatatggagagtgcagaaaagtac
ttaaaagtaacttgtgatttagagactgacaaaaatgcagtcacacaacctgctgtgaaa
gaacttgtggatgtgtatggtaaggatagccacagtgagtatgaaattgaaggtaagcaa
gatgataaagttgtaacagtcacatctgttgaagtcacaattcccaaaaattcagaaaat
gccgtaaagaaccggaaaggagcagacaaagataagaaacaaaaacatgttgaaagcgta
cctaaggtgcaagataaagaaagcagcatcaagaagcaggaagaagtcattgttgaagga
aattacttgaaaaagaaagtgttaacagcaagttttggtagcaggactgttgttgttaaa
gaggcaagggtactgctgatggatattagaaagagtttgagttgcaagtttagtcaacaa
gataaagatgctaatgaccaccaacctccgtgcagttacagtggtataggagaagctgat
aatatgaagacactattacttgctgacaataaagagacaaaggacaagcatgatgcactt
aataacaaaaatgagcaccctaatcaaggactcacggcagctgatcagtcaaatatacat
gaagatactcaagagaaacagtcagaaagcgctttgaattcctcagaacccccatccatg
tgcatggtttctctggatcatagtccccagagcagcattcccctaaagaaacgggcattt
cgagaatcgcttgatacagacccagaacaggatgttaatgtacctgcaacaccgtgtact
gatggcagtaaaggcaaagaacccaactcggaatatctgttacctaagccacgcgaaagc
agcagtgtggatacaacattaatgaaatgttcaataccagaatcaagtttatctctcaaa
gacaatgtttgcattgggtccaaaaagcgtggctcatccaagttgataaagacttcggct
aaacaatactgtaaaggtcttcagagtactcatcgtggaccagggaaaaacagtgtcaga
gttcctgaatacagggatagcacgagtaaagtacatgtttgtgagaggacaatcaatgac
cctaagagtgaaattacagaagcagtcaaatgcaatatgggagagaaaagtgacaaagga
ttaggaggaggaaataaaggaccaggggactgtgagatcacggataatattgaacatgcc
attaaggatgagtggtctacctcagatgatttggataagacggaagaagagcagaggtta
aatgtcagaatccgccttaagagaaaaaggggaaaggagtgggcaatggagtgtacggat
gaggcaaaaagtgttgtggacaagtcaagcccacagcaatgcttggctttagttgaccct
tttagtgccattttggatactgtctcaattttaaatgcagaaatggagaggattcggggt
catggggaggccgataatggcgtaggtttagagaaagccaccaaagcagttcaagacgtc
ctagaacattgcagaaaagaatgcgctgctaagccatgtaaaagacaacaaaaagtatca
gctgttcacattaacaaaaacgttagtacaccaaacgaaattgttgaagacagtagtgat
gttactgacaagcaggtacaacaaaaatcatctagtccaaaaattgaggtggacattgat
gacattaaaccgttacctctgattagattgtgcaggagagctgaaggcaagtgggaggtg
gagtggaaagaagctcaaaatgaagatggaagcactgatactttgcacagggagccaaag
aaattaacatctgtcttttctacagcagcaatagtagaacagatgcctctcggcaaagtt
aaagaggaaaacccgtctcaatgccagaaactaatggcggggcgtagttgtaccttcaga
gatccactgagttttgagacttcacccttaccaatatccctttcacctttgtcactttac
tctccctgttatgatgggctggcaggggttggtaatgtcagtgggagtattcaagcaaaa
gacaatgtaagggagaatgtgtcagacagtctcaatagttttaagactggagttattaga
accgacaacaaaggaagggatgacatttgcttgagccacaatttgtttcagattaataaa
agtctgtcaaaactccaggctctgagccagtcacaggtatgtgagaaaagtgtgcccact
aacaccagtataacctcttctcaggttcagtctccttccatttctccctttaccacggag
tgtagctttagtaactattctgaagatgtgcttgactttccatgtttaaatctcgaaagt
tatgatcagatgcctgcacaaaacaacttggcaagctctttaatagattactgtcctggt
gaaccacataacaccgggtccttcagcagccccttctctcaaagtcccactgatgcatgg
aatccggagaccccttacctaggatcgccaagcccagtgagtaactttagtagtggtgag
gagctatgtttcccggatattgtgtttgctcagtctgacacatcctcatctattggtgca
tctcaactgttcttcaaagataagctgtgtaatacagccacaagttctgctccacttcaa
gaccctgagaaagatctgtacttgtctgatggcgagttgtccaaaactcccatagagctc
caggtccaggaagattcagcattacagtttctccccaaagacttgacaatgtttaacaat
gcatctacaagtgctaaacagcctgggcactcaactgtgcgaattcatcctcaggataaa
aagttacactttcttgattccattattaacacaaagtcctcggagtcataccttgctaaa
atcgacattaaagacaacattcatggtccgctcaacttgcatagctccaaagctaaatcc
gaatctgtctttccaaacctgtcaacacacagtctgcatggtgccggacctcacagtaac
cttgttacacccttccattcacttcacgtaggaaataagtcaacctcacttgctgattat
ccaggtgcattcaattctggtaatgcactttttcgtagcagtgacaagaagcttcctttt
tttccaaaccccaagaatgtctcgaaaactgaggaaggccagaatgcttgtcgaatttct
atggctgcaggcagctcgaaatcccacaacaacatggaaagcatctatgcttgtccgggt
ccatcaagttctcacagtggaaaagagtcttctgctagatgtcctaatgctgagttctca
agattggctgaaaatctgcaaaaaaaaacaaagaacatcccgtccaaacagtaccctact
aatcctggtcagcaaggtgatcgcattcacccagtttatttcatcagctctagcaaaacc
acaacaaacgtcttcaagaacataaagccccagatcacaaggaatgataaagatccatgc
ctgccctccacgtatttattttcctcatcccaaggttctcaatgttacagtacaacacaa
agcaaaccctcaagattggaaaaacctcatgctgttgtggctcccactcaaaacactcaa
ctttctggagtgtcttctatccagcccaataaggatcagatgtgttcaaacatctctcac
tgtgattcttctgctttcaacttcagctcctcgctttcacctcctgcgtcgcagcacagc
agtcctcatctgggatacagagaatcctcagtccctgaggtccctttgtttaaaactcag
tcaaccacctttgaacacggtcaacctcctcaccagtcttacgtagtgaacttcaccgga
gatcattctgtgactctggggtacagtgaggatggtggaagcttgaattatactggttca
ggacctgcaaattacacttaccattgtcttatggagccttcgggaactcaaggaaggctg
gttgtagaagcatgtggtccctcaaacttctcgccttctccctctgcgagtaggtttgca
gggtctaaagtccacggaggccaagtcagtagggatcagcagcatcaggggaccggaact
cacccatgtaattctctacacttctccacctcccactcgcaaagcactcccataacggat
cgcaagcctaagagacttaggcttgtggtgactgacggtacagtggatctggaccttcaa
tatactgattaa

DBGET integrated database retrieval system