KEGG   Sinocyclocheilus grahami: 107564884Help
Entry
107564884         CDS       T04918                                 

Definition
(RefSeq) catenin beta-1-like
  KO
K02105  catenin beta 1
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04310  Wnt signaling pathway
sgh04510  Focal adhesion
sgh04520  Adherens junction
sgh04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107564884
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107564884
   04520 Adherens junction
    107564884
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107564884
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arm Cnd1 Adaptin_N HEAT_2 Atx10homo_assoc Queuosine_synth
Motif
Other DBs
NCBI-GeneID: 107564884
NCBI-ProteinID: XP_016105542
LinkDB All DBs
Position
Unknown
AA seq 786 aa AA seqDB search
MQFYADHASFFPPFFYVANSTHIPPSRVAKHLNYFAYVIYSIISFYNVSCAADLMELDMA
MEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEDEDVDNQMLYEWEQGFNQSF
NQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDSAHPTNVQRLAEPSQMLKH
AVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQM
VSAIVRTMQNTSDVETARCTSGTLHNLSHHREGLLSIFKSGGIPALVKMLGSPVDSVLFY
AITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLI
ILASGGPQALVNIMRAYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPS
QRLVQNCLWTLRNLSDAATKQTSLAEVDVQEGMEGLLGTLVQLLGSDDINVVTCAAGILS
NLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQDAEMAQNAV
RLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQ
DTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDIHNRIVIRGLNTIPLFVQLLYS
PIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSED
KPQDYKKRLSVELTSSLFRTEPMTWNETGDLGLDIGVQGEPLGYRQDGKFIIRNEISSQH
LGVNTH
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
atgcagttctatgcggaccatgcatctttcttcccaccctttttctatgtggccaactcc
acccatattccacctagtagagtggcaaaacatttaaactactttgcttacgttatctat
tcgattatctctttttataatgtttcatgtgcagctgacttgatggagctcgacatggcc
atggagccggatcgcaaggctgcagtcagccattggcagcaacagtcttacctggactca
ggtatccactctggggccacaaccactgccccatccctgagcggcaagggcaacccagag
gatgaggatgtggataatcagatgctgtatgagtgggagcagggctttaaccagtccttc
aaccaggagcaggtagcagacattgatggtcaatatgccatgaccagagcccagagagtc
cgggcggccatgtttcctgagactctagatgagggcatgcagataccttccacacagttc
gactctgcccaccctaccaatgtccagcgcctggccgagccctcacagatgctcaagcat
gccgtggtcaacctcattaactaccaggatgatgcagagctggccacccgcgccattcca
gaactcaccaaactactgaacgatgaggatcaggtggtggtaaataaggcagctgtgatg
gtgcaccagctctcaaagaaggaggcctctcgtcacgccatcatgcgatccccacagatg
gtgtcagccattgtgaggaccatgcagaacactagtgatgtagaaacggcacgctgcacc
tccggcaccctgcacaatctttcccaccacagagaaggcctgctctccatcttcaaatcg
ggaggcattcctgcccttgtcaaaatgcttggttccccagtggactccgtactgttttat
gccattacaactctacacaacctcctactgcaccaggaaggagccaagatggctgtccgt
ctggccggaggcctgcagaaaatggtagccttgttaaacaaaacaaacgtcaaattcctc
gccatcacgacagactgccttcagattctggcatacggcaatcaggagagcaaacttatc
attctggccagtggaggcccacaggctctggtcaacatcatgagggcctacacatatgag
aaactgttgtggaccaccagtcgagtgctcaaagtgctgtctgtttgctccagtaacaaa
ccagccatcgttgaggctggtggcatgcaagcacttggccttcacctcacagaccccagt
cagcgactggtacagaactgcttgtggactttgaggaatctctcggatgctgcaaccaaa
cagacgtctttagcagaagtagatgtgcaggagggtatggaggggctcttgggtaccttg
gtccagttgcttggttcagatgatatcaatgtggtgacgtgtgctgctggaatcctgtcc
aacctcacctgcaacaattacaagaacaagatgatggtgtgccaagtgggcggcatcgag
gcccttgtgcgcactgttcttcgtgctggagaccgagaggacatcacagagcctgctatc
tgcgctctccgtcacctcacatccagacatcaggatgcagagatggcccagaatgcagtg
cggctgcactatgggctgccggtggtggtcaaattgctccaccctccctcacattggcca
ctcattaaggccacagttgggcttatccgtaacctggcactgtgtcccgccaaccatgcc
ccgctcagagagcagggtgccattccccgcctggtgcagcttctggtcagggcccatcag
gacactcagagacgcacctccatgggtggaacacagcagcagtttgtggagggtgtgcgt
atggaggagattgtggagggctgcactggagctctgcacattctagccagagacattcac
aacagaattgtcatcagaggactcaacactattccactgtttgttcagttgctgtattct
cccatcgagaacatccagcgtgtagctgcaggtgtactgtgtgagctggctcaggataag
gaggcagctgaggccatcgaggcagaaggagccaccgctcctctcacagagctcctccac
tctagaaacgagggtgttgctacgtacgctgctgcagttctgttccgtatgtctgaggat
aagccccaggactacaagaaacgactgtctgtggagctcaccagctctctgttcagaact
gagcccatgacctggaacgagactggagatctagggctggacatcggtgtgcagggagag
cctctgggctacagacaggacggtaagttcattatcagaaatgagatcagctctcagcat
ctgggtgtgaatactcactaa

DBGET integrated database retrieval system