KEGG   Sinocyclocheilus grahami: 107565060Help
Entry
107565060         CDS       T04918                                 

Definition
(RefSeq) collagen alpha-1(IX) chain-like
Organism
sgh  Sinocyclocheilus grahami
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen Laminin_G_2 Laminin_G_3
Motif
Other DBs
NCBI-GeneID: 107565060
NCBI-ProteinID: XP_016105729
LinkDB All DBs
Position
Unknown
AA seq 780 aa AA seqDB search
MLVITVLLAVFGLVRCQELATYDLLEEFGLSESRGVRRVNGSEPDAVAYRVNPSLHLKKS
MSDIYPEGLPSDYSVIATFKVPKDTAKTSWNLWQVSDPEGRDQVGLRFQGDTKTLDFFYT
SPQGTQMLRTFQRVEKLFDGEWHKLAFSVKGEQVKLLVDCEEVSVEPLDEPRPVIREGFT
SIVKRAVGDRSVSVDLQKMEVFCDADQAYSEGCCELSSVCGGYAEIGLTAGRGRATCKCV
HGQPGVQGRPGPKGHRGLPGNTGDPGGVGNWGIRGNTGDYGHIGEPGPKGEEGIKGEKGM
RAPRGREGDRGPKGLKGLKGASGHKGVQGSPGERGETGQQGEVGAAGERGYEGIVGYQGV
KGNEGLTGAEGSRGPRGWQGIVGDPGERGTPGEKGKPGIQGPKGKVGGIGEKGIVGDPGL
LGRDGDPGIEAYQGQQGAEGRRGQVGERGEKGEQGPPGEMGPPGLTGPQGYKGSAAKPGR
PGFIGPPGRTGHMGIPGRPGPKGDTGIPGVQGRKEEKGAKGVKGPKGRAGDAGVPGQQGS
RGKRGPAGDLGRKGRVGSKGVRGDGGLVGFQGPPGPPGPTLPAQHVIEVCKRVVLEQMST
FANSVKRTCAAVCPLYGDVPMGAPGPPGPKGPLGPPGDPGIDGLKGEIGQQGFYGEAGDH
GRQGSPGDRGEPGDKGAKGYGLPGHIGEQGPKGQRGRPGQAFDGQTGRMGERGHVGQPGL
RGHPGLRGVPGVCLTSGCALLNATSNAQPRQAPQQAPQRAPQQTPQRSPQRATQRSRGRQ
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atgctggttatcacagtcctgctggctgtctttggccttgtcagatgtcaggaattagca
acatatgacctgttggaagagtttggcttgtccgagtctagaggggtgagaagggtcaat
gggtctgaacctgacgcggtggcgtaccgtgttaacccgtccctccacctcaagaagagc
atgagcgacatctacccggagggtctaccgtcagactactctgtcatcgccaccttcaaa
gtgcccaaggacactgctaaaacatcctggaatctgtggcaagtcagcgatcctgaaggc
cgggaccaggtgggccttcgttttcagggcgacactaaaaccctggacttcttctacacc
agcccgcaaggcacgcagatgctgcggaccttccagagggtggaaaaactatttgacggc
gagtggcacaagctggcatttagtgtaaaaggagagcaggtgaagctgctggtggactgt
gaggaggtcagcgtggagcctctggatgagccacggcccgtgatccgcgaaggttttacc
tccatcgtcaagagggctgtaggtgaccgctcggtttcggtggatctgcaaaagatggag
gtcttctgcgatgcggatcaggcatactctgaaggctgctgtgagctctccagtgtgtgt
ggaggatatgctgagattggcttaactgctggaagaggaagagccacctgtaaatgcgta
cacggacagccgggtgtccagggacgcccaggacccaagggtcacagaggcctgccaggg
aatacgggagacccaggcggagtgggaaactgggggatacgtgggaacactggagattat
ggacatataggagaacctgggcctaagggtgaagaaggcatcaagggagaaaagggcatg
agagcacctcgtggccgggagggtgacagaggacccaaaggcctgaaagggctaaaagga
gcttcgggtcataagggagtgcaagggtcacctggagagaggggtgagactggccagcag
ggggaagttggtgcagcaggagaacggggatacgaggggattgtgggctatcagggagtt
aagggaaatgaaggcttaactggagctgaaggatctcgaggaccacggggttggcagggg
attgtgggagatcccggtgaacgaggaacacctggagaaaagggaaagccaggtattcaa
ggcccaaaaggaaaagttggtggaataggggaaaagggtatagttggtgatccaggtttg
ctagggcgagatggagaccctggaattgaggcttatcaaggacaacagggagctgaggga
agacgtggacaagttggtgaaaggggcgaaaaaggcgaacaagggcctccgggggaaatg
ggccctcctggattaacagggccgcaaggttacaagggctctgctgcaaagccaggaaga
ccaggatttattgggccccctggaagaacggggcacatgggaatacccggcagaccaggc
cccaagggtgacactggcattcctggggtccagggacgcaaagaggagaagggtgcaaag
ggagtcaaaggacctaaaggcagggcaggagacgccggtgtgccagggcaacagggaagt
agaggaaagcgaggccctgctggagatctgggtagaaaaggccgtgtaggctccaaggga
gtgagaggagacggtggtctagtgggctttcagggcccaccaggcccaccaggccccact
cttcctgctcaacatgttatcgaggtctgcaagagggtggtgctggagcagatgtccaca
ttcgccaactccgtgaaaaggacttgtgcggccgtgtgcccactctatggagacgtgcca
atgggtgctccaggtcccccaggaccaaaaggaccacttggacctccaggtgatcctggc
attgatggtcttaaaggagaaatcgggcagcagggattctacggagaagccggtgaccac
ggaagacagggctcaccaggtgacaggggagaaccaggagacaagggagctaaaggctat
ggccttcctggccacattggagagcagggaccaaagggtcagcgtgggcgacctggccag
gcatttgatgggcaaacaggtcggatgggcgagagaggccatgtgggccagcctggtttg
aggggtcatcctggactacgtggagttcctggggtctgtctgacatctgggtgtgcctta
ctcaatgctacttctaatgcacagccacgacaagcacctcagcaggcgcctcaacgggca
cctcaacaaacaccccaacgctcacctcaacgggcaactcagaggtctagaggacggcag
tga

DBGET integrated database retrieval system