KEGG   Sinocyclocheilus grahami: 107565173Help
Entry
107565173         CDS       T04918                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh00052  Galactose metabolism
sgh00500  Starch and sucrose metabolism
sgh01100  Metabolic pathways
sgh04142  Lysosome
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    107565173
   00500 Starch and sucrose metabolism
    107565173
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    107565173
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sgh04147]
    107565173
Enzymes [BR:sgh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     107565173
Exosome [BR:sgh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107565173
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110 GHL15
Motif
Other DBs
NCBI-GeneID: 107565173
NCBI-ProteinID: XP_016105882
LinkDB All DBs
Position
Unknown
AA seq 901 aa AA seqDB search
MVSYKRLTPEEVHFAGAALLDPDETTDTDLKEVNPELPLLPQSRRCSITVALLTLGGLIV
VLFGIWLLGTIFWLHKPPSTEPHRPPPPAVAKSLNGTWLQPESCSQIPEAWRFDCYPERG
AVVTEEMCNARNCCFVQRSQAKTSGRNGMPWCFYTPDYPSYELVSITDTEMGKVGKLLRN
KKTYYPKDIDALQMEVLYEEDNRLRVKITDPAEKRYEVPIDVPVVQKKASNPSYTIDFIK
EPFGLIVKRTQTGTVLLNTSIAPLFYADQFLQMSTSLPSRFIYGLGEHRSNFLHDIQWNT
LTMWARDVPPMELTNLYGVHPFYLSMESDGMAHGFFMLNSNAMDVALQPAPALTWRMIGG
ILDFYIFLGPDPSSVIAQYLDVVGKPAMPIFWALGYHLCRWGYKSSDKTWNVVKEMRNYG
IPQDVQWNDIDYMDHALDFTYDTVNFSSLPDLVKDLHRHDQHYVMMLDPGISNSQLPGSY
WPFDEGMKRGIFINDSNGDVLIGKVWPGLTAFPDFSNPDTHEWWYQNLKRFHEKVPFDGV
WIDMNEPSNFFDGSLNGCPDNELENPPYTPGILGGTLKAKTVCASARQKISTHYNIHSLY
GLMEAKSTESALRKITNKRPFVISRSTFPSQGKYSGHWLGDNRSQWKDLATSIPGMLTFN
ILGIPLIGADICGFGGSTTEELCVRWTQLGAFYPFSRNHNSIDEQDQEPTAFSPAARTAM
KEAILLRYSLFPHLYTLFYHAHISGHTVATPLLFQFPNDEKTYGIDKQFLWGKNLLVTPV
LEAGRDYVVGYFPKGLWYDFHTGDSLISSGEEINLQAPKDKINLHLGEGSVVPTQRPNTT
LWVSSGQPLHLIVSLSEDGLAKGDLFWDDGETLDTYEKDQYAYIYFTVEQVQKMHNSPLL
Q
NT seq 2706 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcgtacaagagactcacccctgaggaggttcatttcgcaggagctgctttattg
gatcctgatgagacgacagacacggatctaaaggaagtaaacccagaactgcccctgctg
ccccagagccgtcgctgctccatcaccgttgccctgctgacccttgggggacttattgtg
gttctctttggcatctggctacttggaactatattttggttacataagccaccctccaca
gaaccccatagaccccctccacctgctgtggctaaaagcctaaacgggacgtggctgcag
ccggagtcctgctcgcagattccagaagcttggaggtttgactgttatccagagagaggt
gcggtggtgacggaggagatgtgcaacgctcgaaactgctgcttcgtacagcgctcacag
gctaagacatcgggacggaatggaatgccgtggtgtttctacacacctgactatccatcc
tacgagttggtgtccattactgacacagagatggggaaggtgggaaaactgctccggaac
aaaaagacatattatcctaaagacatagatgcactgcagatggaggtgctgtatgaggaa
gacaacagactgcgtgtgaagataacagacccggctgaaaagaggtatgaggtgcctata
gatgttcctgtggttcagaaaaaagcatcaaatccctcttacaccatagacttcatcaaa
gaacctttcgggctgattgtcaagagaacacagacaggaactgtactgttgaatacatct
atagctcctctcttctacgcggatcagttcctgcagatgtctacatcattaccttcacgt
ttcatatatggactgggtgaacatcgctccaactttctgcatgacatccagtggaacact
ctcaccatgtgggctcgagatgtcccaccaatggagctgaccaacctctatggcgtccat
cccttttatctttctatggaatctgatggaatggcacatgggtttttcatgctcaacagc
aatgcaatggatgtggctctgcagcctgctcctgccctcacctggcgtatgattggtggg
atcctcgacttttacattttcctaggcccggatcccagctctgtaattgcacagtacttg
gatgttgtagggaagcctgcaatgcccatcttctgggctctgggttatcatctttgccga
tggggctacaagtcaagcgacaaaacctggaatgttgtaaaagaaatgcggaattatggg
atacctcaggatgttcagtggaatgacattgactacatggatcatgccttagacttcact
tatgacactgtgaacttttccagcctacctgaccttgtgaaagaccttcatagacatgat
caacactatgtcatgatgctggatcccggtatcagtaactctcagctgcctggctcctac
tggccatttgatgaggggatgaagaggggcatcttcatcaatgattcgaatggagacgtc
cttatcgggaaggtctggccaggactcacagcttttccagatttctccaatccagacaca
catgaatggtggtaccagaatctgaagcgtttccatgaaaaagtgccgtttgatggcgtg
tggattgacatgaatgagccatctaatttctttgatggatcactgaatggttgcccagac
aatgaactggaaaatcctccctacacaccaggtattctgggtggtacattaaaggccaag
actgtgtgtgcatctgcaagacagaaaatctccactcattacaacatacacagtctgtat
ggactcatggaagctaagtctactgaaagtgctttgaggaagatcacaaataagcgcccc
tttgtcatttcccgctctacgtttcccagtcagggcaagtattcaggccactggctcgga
gacaacaggagccaatggaaagacctggccacatccataccaggtatgctaacatttaac
atcctgggcattcctcttattggggctgacatctgtggctttgggggcagcactacagaa
gaactgtgtgtccgatggacccagcttggagctttctaccccttttcaagaaaccacaac
tccatagatgaacaggatcaggaaccaacagcattcagcccagcagctcgtacagcaatg
aaagaagccattctcctgcgttattccctgttcccacatctctacacactcttctatcac
gcacatatcagtggacacacagtcgccacaccactgctctttcagttcccgaacgatgag
aagacgtacgggatagataaacaattcctgtggggaaagaatttgctggtcacacccgtt
ttggaggcagggcgagattatgttgtgggatatttccctaaaggtctctggtacgatttc
cacactggtgactcgttgataagcagtggagaagagatcaatcttcaggctccaaaagac
aaaatcaacctgcatctcggagagggttcagtcgtacctacacagagacctaataccacc
ctgtgggtgagcagcggtcagccccttcatctgattgtgagtctgagtgaggacggcctg
gccaagggtgatttgttttgggatgatggagagacccttgacacatatgagaaagatcaa
tacgcttacatctatttcacagtagaacaggtacagaaaatgcacaattcacctttacta
cagtaa

DBGET integrated database retrieval system